BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_F18 (609 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43343| Best HMM Match : fn3 (HMM E-Value=3.4e-39) 28 6.8 SB_9716| Best HMM Match : HMG_box (HMM E-Value=0.0041) 27 9.0 >SB_43343| Best HMM Match : fn3 (HMM E-Value=3.4e-39) Length = 2865 Score = 27.9 bits (59), Expect = 6.8 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 75 TFQFHTCAIILDHHLIFLTGIF*SRNCLNIVLPTRIK 185 T QFH+CAI + L+ L G SR + VL R++ Sbjct: 325 TAQFHSCAIPAEMRLVLLRGKQKSRTMESSVLSPRME 361 >SB_9716| Best HMM Match : HMG_box (HMM E-Value=0.0041) Length = 169 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -3 Query: 598 N*CLYISV-YMYYYIFNLRISLVSLIEHLLVKHII 497 N C Y+SV Y YYY++ SLV IEH + I+ Sbjct: 86 NICSYLSVVYYYYYLY----SLVCEIEHRAISVIL 116 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,147,567 Number of Sequences: 59808 Number of extensions: 313519 Number of successful extensions: 537 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 492 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 534 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1487884875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -