BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_F14 (562 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0179 - 1412391-1412863,1412947-1413412,1413504-1414551,141... 30 1.5 05_06_0022 + 24988363-24988453,24989102-24989325,24989433-249894... 27 7.7 03_05_0398 + 23790257-23790323,23791116-23791339,23792208-237922... 27 7.7 >11_01_0179 - 1412391-1412863,1412947-1413412,1413504-1414551, 1414639-1414725,1416244-1416411,1416785-1416958, 1417662-1417720,1418132-1420154,1420549-1420647, 1420998-1421796,1422101-1422120,1422446-1422513 Length = 1827 Score = 29.9 bits (64), Expect = 1.5 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +1 Query: 256 TTTPETLVFFVKFATSKKVVLC-SQSNL*PKMAKECLNG 369 T T + FVK S LC Q NL P ECLNG Sbjct: 998 TLTTQMRAIFVKTLCSYSTGLCYEQRNLDPAFGPECLNG 1036 >05_06_0022 + 24988363-24988453,24989102-24989325,24989433-24989494, 24990219-24990440,24990740-24990869,24991373-24991698, 24991910-24992051,24992169-24992414 Length = 480 Score = 27.5 bits (58), Expect = 7.7 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = +1 Query: 445 KDVIINLSLSINPFISKAVFIKRVVHR 525 +DVI++ ++S PF+ + + + R VHR Sbjct: 264 RDVIMDGTMSWEPFVQQTITMARAVHR 290 >03_05_0398 + 23790257-23790323,23791116-23791339,23792208-23792275, 23794738-23794980,23795108-23795237,23797235-23797954 Length = 483 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +1 Query: 445 KDVIINLSLSINPFISKAVFIKRVVHR 525 +DVI++ +LS PF+ + + + R VHR Sbjct: 265 RDVILDGTLSWEPFVQQTIAMARDVHR 291 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,231,186 Number of Sequences: 37544 Number of extensions: 188902 Number of successful extensions: 351 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 350 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 350 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1281410928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -