BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_F14 (562 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54416| Best HMM Match : rve (HMM E-Value=1.4e-27) 29 2.0 SB_20205| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 >SB_54416| Best HMM Match : rve (HMM E-Value=1.4e-27) Length = 1068 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/57 (24%), Positives = 27/57 (47%) Frame = +3 Query: 240 KKSRVNYNPRNPSFFCEICNFKEGCTVFTKQSVTKNGKGMFKWLSNNAYEIQCAIFN 410 K N+ F+ N+ C + TK+ +T++ K + KW+ +N E+ + N Sbjct: 256 KAKGTNFQVEESQFYVG-ANYINICHLHTKEWLTEDDKKLKKWIQDNFAEVTQKVIN 311 >SB_20205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +3 Query: 123 YVNMDLLPYLSTLNFNSIS*NYCCNVNNIL 212 Y+N+D PYL+T N+N I ++ C N L Sbjct: 33 YLNLD--PYLATKNYNIIGGDFNCITNTRL 60 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,332,468 Number of Sequences: 59808 Number of extensions: 261580 Number of successful extensions: 506 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 468 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 505 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1312894764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -