BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_F12 (453 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF164153-1|AAD47077.1| 131|Anopheles gambiae ribosomal protein ... 188 6e-50 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 24 2.2 AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. 23 3.8 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 22 8.8 >AF164153-1|AAD47077.1| 131|Anopheles gambiae ribosomal protein S17 protein. Length = 131 Score = 188 bits (459), Expect = 6e-50 Identities = 91/106 (85%), Positives = 98/106 (92%) Frame = -1 Query: 330 IEKYYTRLTLDFDTNKRICEEIAIIPTKPLRNKIAGFATHLMRRLRHSQVRGISIKLQEE 151 IEKYYTRLT+DFDTNKRI EE+AIIPTKPLRNKIAGF THLM+RLRHSQVRGISIKLQEE Sbjct: 17 IEKYYTRLTMDFDTNKRIVEEVAIIPTKPLRNKIAGFVTHLMKRLRHSQVRGISIKLQEE 76 Query: 150 ERERRDNYVPEVSALEHDIIEVDPDTKDMLKMLDFNXINGLQLTQP 13 ERERRDNYVP+VSALE DIIEVDP+TK+MLK LDFN I +QLT P Sbjct: 77 ERERRDNYVPDVSALEQDIIEVDPETKEMLKHLDFNNI-VVQLTNP 121 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 24.2 bits (50), Expect = 2.2 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -2 Query: 200 VSDTRKCEESLSNFRKRSVRGVTTMSQKCLLSNMTS 93 +++TR C E++S F+ R T+ +K + + TS Sbjct: 356 INETRVCGENISTFQLEERRRRRTVIEKLNIEDGTS 391 >AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. Length = 260 Score = 23.4 bits (48), Expect = 3.8 Identities = 11/40 (27%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = -1 Query: 177 GISIKLQEEERERRDNYVPEVSALE-HDIIEVDPDTKDML 61 G + +L+EEE + + + PE+ E + ++V + K+M+ Sbjct: 87 GTTCELEEEEVDLQAKHAPEMDGSELMEAVDVAAELKNMV 126 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 22.2 bits (45), Expect = 8.8 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +1 Query: 331 NNLRRFLDGFSPDTTHG*SCTALLLTESKRSEKASAGRI 447 +NLRR P T S ALL + SE+ S GR+ Sbjct: 921 SNLRRKGPQVRPTLTPRHSERALLSDSTSSSERNSVGRL 959 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 423,593 Number of Sequences: 2352 Number of extensions: 7824 Number of successful extensions: 14 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 38694201 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -