BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_F06 (670 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U88308-6|AAB42320.1| 180|Caenorhabditis elegans Hypothetical pr... 31 0.56 Z81542-3|CAB04415.1| 308|Caenorhabditis elegans Hypothetical pr... 28 5.2 >U88308-6|AAB42320.1| 180|Caenorhabditis elegans Hypothetical protein C32E8.3 protein. Length = 180 Score = 31.5 bits (68), Expect = 0.56 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = -2 Query: 363 ELTGNDIAKQCQAAGCICNLALGDSRAGVAVTKSAGPYLIAALDNLTTELA 211 E+TG + K + AG + N A+ + G+A +K GP A D LA Sbjct: 31 EMTGKNFDKWLKDAGVLDNKAITGTMTGIAFSKVTGPKKKATFDETKKVLA 81 >Z81542-3|CAB04415.1| 308|Caenorhabditis elegans Hypothetical protein F49A5.4 protein. Length = 308 Score = 28.3 bits (60), Expect = 5.2 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 80 YFSTPPIFYTPLKLENHNCM 21 Y TPP+F ++LEN NC+ Sbjct: 259 YDGTPPLFTNMIQLENGNCL 278 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,505,122 Number of Sequences: 27780 Number of extensions: 249790 Number of successful extensions: 519 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 491 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 519 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1508017654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -