BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_F03 (632 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 26 0.23 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 26 0.30 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 24 1.2 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 23 2.1 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 21 6.5 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 26.2 bits (55), Expect = 0.23 Identities = 18/55 (32%), Positives = 26/55 (47%) Frame = +2 Query: 452 VLTVVMKNWEPLVSAPALAMERTPGPVCLRVKFSSSNLLP*MDFPPVPLWLVKSP 616 VL + M +EP P++ PGP F +N LP PP+PL + +P Sbjct: 143 VLNLTMPKYEP---NPSII---DPGPALPPAGFLCNNYLPLPQVPPLPLPPIFAP 191 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 25.8 bits (54), Expect = 0.30 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -1 Query: 206 YGSFQLFNKILLLM*RTGYCIYFHALLVCSLLHFCYYI 93 Y +F LF LLL+ Y Y H L C+ + F ++ Sbjct: 242 YYAFILFTVHLLLLVCIYYFYYMHLLFCCAFIIFTMHL 279 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 23.8 bits (49), Expect = 1.2 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = -1 Query: 194 QLFNKILLLM*RTGYCIYFHALLVCSLLH 108 +L K +++M +G I+ + +CSL+H Sbjct: 1151 KLVIKAIIIMILSGCIIFTEGIWICSLIH 1179 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 23.0 bits (47), Expect = 2.1 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = +2 Query: 452 VLTVVMKNWEPLVSAPALAMERTPGPVCLRVKFSSSNLLP*MDFPPVPL 598 VL + M +EP P++ PGP F +N P PP+PL Sbjct: 143 VLNLTMPKYEP---NPSII---DPGPALPPTGFLCNNYPPLPQVPPLPL 185 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 21.4 bits (43), Expect = 6.5 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +1 Query: 508 HGENARSSVLKGEILVLEL 564 H N R KGE+ VLE+ Sbjct: 384 HHANLRQKNQKGEVTVLEI 402 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,807 Number of Sequences: 336 Number of extensions: 3178 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16292796 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -