BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_F03 (632 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small... 24 3.5 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 4.6 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 6.1 AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14... 23 8.1 >AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small GTPase protein. Length = 190 Score = 24.2 bits (50), Expect = 3.5 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = -2 Query: 484 WFPVLHHHCQD 452 W+P + HHC D Sbjct: 100 WYPEIKHHCPD 110 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.8 bits (49), Expect = 4.6 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -3 Query: 450 SWLDGRHVVFGNVVEGMEVVKQIETFGSQSGKTSK 346 SWL HV V E +V+ +GS S +T+K Sbjct: 3198 SWLLLAHVAPAAVREVKRIVQNFFGWGSSSSRTTK 3232 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.4 bits (48), Expect = 6.1 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = -1 Query: 632 ISXYKEGTSPTITALGESPSTAISSRTRISPLSTLDLAFSPW 507 +S T+PT TA G + + +S+ ++L L SP+ Sbjct: 517 VSEITRTTAPTATAAGTAKARKVSAGVATIQKASLSLPGSPF 558 >AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14D2 protein. Length = 372 Score = 23.0 bits (47), Expect = 8.1 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 389 LTTSMPSTTFPKTTCLPSSQEVLTV 463 L+ ++ T F + CLP+S+E TV Sbjct: 226 LSETVEFTDFIRPICLPTSEESRTV 250 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 637,445 Number of Sequences: 2352 Number of extensions: 13075 Number of successful extensions: 29 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61886940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -