BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_F01 (651 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49232| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_40725| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_43623| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 >SB_49232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 313 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 134 ERHSHSHGVVSHIYATVNLSRWQRSTS*CV 223 +R SH+H + ++ + LSRW R S CV Sbjct: 158 QRTSHAHQISRNMSINLTLSRWLRKMSMCV 187 >SB_40725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -2 Query: 632 IPXMVKKIDLAPTVESDA-AAVPEIKTPEAADAPKLADNPVDEDKPADI 489 +P VK++ P + + +K P A AP P D DKPA + Sbjct: 338 VPEPVKEVPARPVTKQEPFKQTKPVKEPSLAPAPTANMVPSDRDKPAGL 386 >SB_43623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -2 Query: 290 DRGGVKRRTRVDSLRHASTACSEHINSCSAA 198 D GG+KR + V+++R AS H SC AA Sbjct: 341 DYGGLKRSSGVNTVRPASDPQVTHEKSCEAA 371 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,099,515 Number of Sequences: 59808 Number of extensions: 224795 Number of successful extensions: 603 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 524 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 600 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -