BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_E24 (702 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 29 0.037 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 29 0.037 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 29 0.037 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 29 0.037 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 4.2 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 4.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.6 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 21 9.7 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 21 9.7 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 21 9.7 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 29.1 bits (62), Expect = 0.037 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +1 Query: 25 APSS-FLLAPLHRIFLCAAVGKSHFSCLTPSVCYVETWPAKY 147 +PS+ FL+A F+ A + F C+ P + Y+ + P+ Y Sbjct: 1002 SPSAIFLIAMTGSFFIAACLHPQEFWCIVPGIIYLLSIPSMY 1043 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 29.1 bits (62), Expect = 0.037 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +1 Query: 25 APSS-FLLAPLHRIFLCAAVGKSHFSCLTPSVCYVETWPAKY 147 +PS+ FL+A F+ A + F C+ P + Y+ + P+ Y Sbjct: 1002 SPSAIFLIAMTGSFFIAACLHPQEFWCIVPGIIYLLSIPSMY 1043 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 29.1 bits (62), Expect = 0.037 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +1 Query: 25 APSS-FLLAPLHRIFLCAAVGKSHFSCLTPSVCYVETWPAKY 147 +PS+ FL+A F+ A + F C+ P + Y+ + P+ Y Sbjct: 1002 SPSAIFLIAMTGSFFIAACLHPQEFWCIVPGIIYLLSIPSMY 1043 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 29.1 bits (62), Expect = 0.037 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +1 Query: 25 APSS-FLLAPLHRIFLCAAVGKSHFSCLTPSVCYVETWPAKY 147 +PS+ FL+A F+ A + F C+ P + Y+ + P+ Y Sbjct: 1002 SPSAIFLIAMTGSFFIAACLHPQEFWCIVPGIIYLLSIPSMY 1043 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.2 bits (45), Expect = 4.2 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 103 LTPSVCYVETWPAKYDVKVQSINSN*GIVLD 195 LT +VC+V A + K SIN N + LD Sbjct: 190 LTNAVCFVPGVVAMFSRKPCSINENLKMGLD 220 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.2 bits (45), Expect = 4.2 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 103 LTPSVCYVETWPAKYDVKVQSINSN*GIVLD 195 LT +VC+V A + K SIN N + LD Sbjct: 190 LTNAVCFVPGVVAMFSRKPCSINENLKMGLD 220 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 5.6 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +2 Query: 392 ENTGCCPVSCSNTLAARVSLSPDSP 466 ENT C P + S + + PD P Sbjct: 2280 ENTECHPDASSTMAPSTTPMVPDKP 2304 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +3 Query: 228 QNYPWRRSCHAA 263 Q YPW R H A Sbjct: 209 QIYPWMRKVHVA 220 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +3 Query: 228 QNYPWRRSCHAA 263 Q YPW R H A Sbjct: 209 QIYPWMRKVHVA 220 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +3 Query: 228 QNYPWRRSCHAA 263 Q YPW R H A Sbjct: 209 QIYPWMRKVHVA 220 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,958 Number of Sequences: 336 Number of extensions: 3638 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18530690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -