BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_E21 (737 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 27 0.16 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 25 0.64 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 23 3.4 AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochr... 22 5.9 AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 21 7.9 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 21 7.9 AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A prot... 21 7.9 AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII pr... 21 7.9 AF017414-2|AAB70261.1| 150|Tribolium castaneum abdominal-A prot... 21 7.9 AF017414-1|AAB70260.1| 209|Tribolium castaneum abdominal-AII pr... 21 7.9 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 27.1 bits (57), Expect = 0.16 Identities = 16/57 (28%), Positives = 22/57 (38%) Frame = -1 Query: 635 SRTRSVWTSSPTN*KRPVSSPRTLTENPTRFRENWPSLKTNSKSPKTVSSLVTLRSQ 465 S T S W ++ T + + P T + NWP+ T P V V SQ Sbjct: 1045 STTTSPWWTTTTTRRTTTTRPTTTSTTTRPTTTNWPTQGTTIPPPAVVMPEVDKPSQ 1101 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 25.0 bits (52), Expect = 0.64 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = -1 Query: 611 SSPTN*KRPV-SSPRTLTENPTRFRENWPSLKTNSKSPKTVSSLVTLRSQS 462 +SPT P SSPR+++E+P R+ P+ + NS+ ++ SLV R S Sbjct: 53 ASPTPGDVPTPSSPRSISEDPLNCRD-LPNSRCNSR--ESSDSLVQPRCPS 100 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = -1 Query: 200 SWLVTKLSHSTYRPQTHTNRTCTHTYAA 117 SW + +++PQ CTH + A Sbjct: 32 SWAGYRNGEGSFKPQNINANLCTHVHYA 59 >AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 126 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +1 Query: 145 FVCVCGLYVECESLVTSQL 201 F+C+ G+Y E + V +L Sbjct: 8 FICILGVYPEIQEKVYQEL 26 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +1 Query: 121 AYVCVHVLFVCVCGLYVECES 183 A + + ++ VC+CG V ES Sbjct: 202 ALLIMRLISVCLCGASVHSES 222 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 437 PTTFNSSSSSEILASPD 487 P F ++SSS L SPD Sbjct: 216 PAEFPTTSSSSALESPD 232 >AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A protein. Length = 284 Score = 21.4 bits (43), Expect = 7.9 Identities = 12/48 (25%), Positives = 19/48 (39%) Frame = -1 Query: 203 PSWLVTKLSHSTYRPQTHTNRTCTHTYAAPLPHTHKHMYINYTTTRRH 60 PS+ T S T+++C +T T +NYT + H Sbjct: 29 PSFSSTASSALAAAVDAATDKSCRYTAGLAANVTPADSMVNYTLGQHH 76 >AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII protein. Length = 343 Score = 21.4 bits (43), Expect = 7.9 Identities = 12/48 (25%), Positives = 19/48 (39%) Frame = -1 Query: 203 PSWLVTKLSHSTYRPQTHTNRTCTHTYAAPLPHTHKHMYINYTTTRRH 60 PS+ T S T+++C +T T +NYT + H Sbjct: 88 PSFSSTASSALAAAVDAATDKSCRYTAGLAANVTPADSMVNYTLGQHH 135 >AF017414-2|AAB70261.1| 150|Tribolium castaneum abdominal-A protein. Length = 150 Score = 21.4 bits (43), Expect = 7.9 Identities = 12/48 (25%), Positives = 19/48 (39%) Frame = -1 Query: 203 PSWLVTKLSHSTYRPQTHTNRTCTHTYAAPLPHTHKHMYINYTTTRRH 60 PS+ T S T+++C +T T +NYT + H Sbjct: 29 PSFSSTASSALAAAVDAATDKSCRYTAGLAANVTPADSMVNYTLGQHH 76 >AF017414-1|AAB70260.1| 209|Tribolium castaneum abdominal-AII protein. Length = 209 Score = 21.4 bits (43), Expect = 7.9 Identities = 12/48 (25%), Positives = 19/48 (39%) Frame = -1 Query: 203 PSWLVTKLSHSTYRPQTHTNRTCTHTYAAPLPHTHKHMYINYTTTRRH 60 PS+ T S T+++C +T T +NYT + H Sbjct: 88 PSFSSTASSALAAAVDAATDKSCRYTAGLAANVTPADSMVNYTLGQHH 135 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,935 Number of Sequences: 336 Number of extensions: 2236 Number of successful extensions: 13 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19779950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -