BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_E20 (756 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40253| Best HMM Match : Spectrin (HMM E-Value=5.9e-16) 29 4.1 SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) 28 9.4 >SB_40253| Best HMM Match : Spectrin (HMM E-Value=5.9e-16) Length = 1222 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/60 (26%), Positives = 29/60 (48%) Frame = +3 Query: 51 GIVFKVVCKCSALLLPWRSRCVFKMALFHFIPFRKHNTNMPHNRLPVSINLLNSMQYLCS 230 G++ +V + +A+L+ R +CVF F + + H+R V N N + +L S Sbjct: 553 GLLGEVRRRIAAVLIVHRHQCVFAYVRLRLFAFARLHYPTLHSRRVVDTNNANRLHFLTS 612 >SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) Length = 694 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/56 (23%), Positives = 23/56 (41%) Frame = +1 Query: 385 VVYSTKNS*HLHHKAHNEEHSRLSAVH*H*NKINVHLQLLNHRIH*RKSEAVYKII 552 V+Y + H HH H+ +H+ H H + + H +H H + + I Sbjct: 205 VIYRRHHQHHQHHHHHHHQHNHHHHHHNHHHHHHHHYHHYHHHHHHHNNNTIITTI 260 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,753,809 Number of Sequences: 59808 Number of extensions: 418465 Number of successful extensions: 847 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 788 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 841 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -