BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_E18 (641 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14608| Best HMM Match : AhpC-TSA (HMM E-Value=0) 256 8e-69 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 158 3e-39 SB_22073| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 3e-20 SB_35139| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_33971| Best HMM Match : AhpC-TSA (HMM E-Value=2e-06) 46 2e-05 SB_34154| Best HMM Match : UvrD-helicase (HMM E-Value=0.064) 31 0.80 SB_35926| Best HMM Match : Bac_DNA_binding (HMM E-Value=7.5) 29 3.2 SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_54429| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_37636| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_49880| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_7856| Best HMM Match : F5_F8_type_C (HMM E-Value=3.6e-11) 28 7.4 SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_12584| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 >SB_14608| Best HMM Match : AhpC-TSA (HMM E-Value=0) Length = 265 Score = 256 bits (628), Expect = 8e-69 Identities = 114/153 (74%), Positives = 132/153 (86%) Frame = -2 Query: 640 LSXYKGKYVVLFFYPLDFTFVCPTEIIAFSEKADEFRKIGCEVLGASTDSHFTHLAWINT 461 LS YKGKYVVLFFYPLDFTFVCPTEIIAFS++ DEF+ I CEV+ S DS ++HLAW N Sbjct: 76 LSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDRVDEFKAINCEVIACSVDSEYSHLAWTNV 135 Query: 460 PRKQGGLGPMNIPLISDKSHRISRDYGVLDEETGIPFRGLFIIDDKQNLRQITINDLPVG 281 PRK+GG+G +NIP++SD + +IS+DYGVL E+ G+ RGLFIIDDK LRQITINDLPVG Sbjct: 136 PRKKGGIGNINIPILSDLTKQISKDYGVLLEDQGVALRGLFIIDDKGILRQITINDLPVG 195 Query: 280 RSVEETLRLVQAFQFTDKHGEVCPANWRPGAKT 182 RSV+ETLRL+QAFQFTDKHGEVCPA WRPGA T Sbjct: 196 RSVDETLRLIQAFQFTDKHGEVCPAGWRPGADT 228 >SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) Length = 704 Score = 158 bits (384), Expect = 3e-39 Identities = 71/95 (74%), Positives = 83/95 (87%) Frame = -2 Query: 466 NTPRKQGGLGPMNIPLISDKSHRISRDYGVLDEETGIPFRGLFIIDDKQNLRQITINDLP 287 N PRK+GG+G +NIP++SD + +IS+DYGVL E+ G+ RGLFIIDDK LRQITINDLP Sbjct: 3 NVPRKKGGIGNINIPILSDLTKQISKDYGVLLEDQGVALRGLFIIDDKGILRQITINDLP 62 Query: 286 VGRSVEETLRLVQAFQFTDKHGEVCPANWRPGAKT 182 VGRSV+ETLRL+QAFQFTDKHGEVCPA WRPGA T Sbjct: 63 VGRSVDETLRLIQAFQFTDKHGEVCPAGWRPGADT 97 >SB_22073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 95.5 bits (227), Expect = 3e-20 Identities = 41/57 (71%), Positives = 48/57 (84%) Frame = -2 Query: 640 LSXYKGKYVVLFFYPLDFTFVCPTEIIAFSEKADEFRKIGCEVLGASTDSHFTHLAW 470 LS ++GKY+V FFYPLDFTFVCPTEIIAFS++ +EFR I EV+G S DS FTHLAW Sbjct: 78 LSDFEGKYLVFFFYPLDFTFVCPTEIIAFSDRIEEFRAINTEVVGCSVDSVFTHLAW 134 Score = 77.4 bits (182), Expect = 9e-15 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -2 Query: 346 GLFIIDDKQNLRQITINDLPVGRSVEETLRLVQAFQFTDKH 224 GLFIIDDK LRQIT+NDLPVGRSV+ETLRLVQAFQ+TDKH Sbjct: 135 GLFIIDDKGVLRQITMNDLPVGRSVDETLRLVQAFQYTDKH 175 >SB_35139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 79.8 bits (188), Expect = 2e-15 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = -2 Query: 286 VGRSVEETLRLVQAFQFTDKHGEVCPANWRPGAKTIKPDTKAAQEYF 146 VGRSV+ETLRLVQAFQ+TDKHGEVCPA W+PG TI PD ++YF Sbjct: 1 VGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGKDTIIPDPTQKKKYF 47 >SB_33971| Best HMM Match : AhpC-TSA (HMM E-Value=2e-06) Length = 160 Score = 46.4 bits (105), Expect = 2e-05 Identities = 32/131 (24%), Positives = 56/131 (42%), Gaps = 12/131 (9%) Frame = -2 Query: 508 GASTDSHFTHLAWINTPRKQG-----GLGPMNIPLISDKSHRISRDYGVLD----EETGI 356 G S D +H W+ K N P+I+D+ ++ G++D + G+ Sbjct: 3 GLSCDDAESHRGWVKDITKYNLEQNKSSAKFNYPIIADERRELAVKLGMVDPDEKDSKGL 62 Query: 355 PF--RGLFIIDDKQNLRQITINDLPVGRSVEETLRLVQAFQFTDKHGEVCPANWRPGAK- 185 P R +FII + L+ + GR+ +E LR++ + Q T P +W+ G Sbjct: 63 PLTCRAVFIIGPDKKLKLSILYPATTGRNFDEILRVIDSLQLTATKKVATPVDWKLGGDC 122 Query: 184 TIKPDTKAAQE 152 + P K +E Sbjct: 123 MVIPSIKPEEE 133 >SB_34154| Best HMM Match : UvrD-helicase (HMM E-Value=0.064) Length = 1064 Score = 31.1 bits (67), Expect = 0.80 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 3/69 (4%) Frame = -2 Query: 418 ISDKSHRISRDYGVLDEETGIPFRGLFIIDDKQNLRQITINDLPVGR-SVEE--TLRLVQ 248 + DKS R + LD+ GI G ++ + N+ +ITIN+ + ++ TL V Sbjct: 137 VQDKSG--IRIFSDLDDAHGIIDFGKRLLTEDTNIIEITINNTSTTQVKIKRFSTLEEVP 194 Query: 247 AFQFTDKHG 221 F F+DKHG Sbjct: 195 EFSFSDKHG 203 >SB_35926| Best HMM Match : Bac_DNA_binding (HMM E-Value=7.5) Length = 380 Score = 29.1 bits (62), Expect = 3.2 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -1 Query: 239 VHGQARRGVPRQLEARRQDHQARHQGRPGVLRRRQLD 129 VH + R+G +L + + R QG+ VLR RQ D Sbjct: 262 VHPRPRQGTDVRLPLQLHQREVRRQGKATVLRYRQSD 298 >SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1755 Score = 29.1 bits (62), Expect = 3.2 Identities = 14/58 (24%), Positives = 25/58 (43%) Frame = -1 Query: 458 AQAGRTRPHEHSSDKRQVAPHLPRLRSAGRGDGHSLPRTLHHRRQAEPQADHDQRPAR 285 + AG + +R+ A H PR+ G G+ HS+P + +P + P + Sbjct: 18 SSAGEESLADSGEGRRENARHKPRVMIGGEGEKHSVPAVITIPSVTDPGVAEGRPPRK 75 >SB_54429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 383 Score = 28.3 bits (60), Expect = 5.6 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = -1 Query: 224 RRGVPRQLEARRQDHQARHQGRPGVLRRRQLDTTPHQQS 108 R G +LE RQDH +R RP RRR+ D Q++ Sbjct: 223 REGGQEKLE--RQDHVSRTYQRPSADRRRKEDNVHRQET 259 >SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3293 Score = 28.3 bits (60), Expect = 5.6 Identities = 18/61 (29%), Positives = 24/61 (39%) Frame = -1 Query: 467 QHAAQAGRTRPHEHSSDKRQVAPHLPRLRSAGRGDGHSLPRTLHHRRQAEPQADHDQRPA 288 QH+ T P + SS +Q PH P R R T H+ + PQ+ A Sbjct: 784 QHSESVSETSP-QLSSTAQQTPPHSPATRHNARTSSPQSLATRHNAWTSSPQSPATLHNA 842 Query: 287 R 285 R Sbjct: 843 R 843 >SB_37636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 28.3 bits (60), Expect = 5.6 Identities = 17/57 (29%), Positives = 21/57 (36%) Frame = -1 Query: 455 QAGRTRPHEHSSDKRQVAPHLPRLRSAGRGDGHSLPRTLHHRRQAEPQADHDQRPAR 285 Q GR RP++H V H PR R R S P + R H + R Sbjct: 147 QTGRMRPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPR 203 >SB_49880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 356 Score = 27.9 bits (59), Expect = 7.4 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = -1 Query: 224 RRGVPRQLEARRQDHQARHQGRPGVLRR 141 RR +PR LE +RQ Q R R +LRR Sbjct: 299 RRRIPRLLEQQRQIRQQRLPERLAILRR 326 >SB_7856| Best HMM Match : F5_F8_type_C (HMM E-Value=3.6e-11) Length = 334 Score = 27.9 bits (59), Expect = 7.4 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Frame = -2 Query: 412 DKSHRISRDYGVLDEETGIPFRGLFIIDDKQNLRQI--TIND 293 D ++ Y V+D+ET I GL I +K+N +++ T ND Sbjct: 275 DTIREVNCRYNVVDKETRIKVTGLLTIKEKKNGKELYRTRND 316 >SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1926 Score = 27.9 bits (59), Expect = 7.4 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -1 Query: 452 AGRTRPHEHSSDKRQVAPHLPRLRSAGRGDGHSLPR 345 +G+ P SSD R L LRS G +SLPR Sbjct: 399 SGKEGPMSDSSDLRAALKELAYLRSIQTGGEYSLPR 434 >SB_12584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 692 Score = 27.5 bits (58), Expect = 9.8 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 5/66 (7%) Frame = -1 Query: 212 PRQLEARRQDHQARHQGRPGVLRRRQLDTTPHQQSL*LNTQF-----RKGHISENVKCSG 48 P Q A + + + +PG +R D H+ S+ LNT+F G S + G Sbjct: 475 PCQRSADQSPYPTQRDSQPGAGKRPCSDAGRHRHSMALNTKFAILPTSPGRSSPSFFSDG 534 Query: 47 IEKKTD 30 +++ TD Sbjct: 535 LKRVTD 540 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,953,597 Number of Sequences: 59808 Number of extensions: 323551 Number of successful extensions: 1438 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1340 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1435 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -