BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_E17 (800 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41219| Best HMM Match : EF1G (HMM E-Value=3.3e-38) 118 6e-27 SB_48657| Best HMM Match : GST_C (HMM E-Value=5.8e-07) 52 4e-07 SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) 30 2.5 SB_40630| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_24051| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_28074| Best HMM Match : Helicase_C (HMM E-Value=4.2) 29 5.8 SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) 28 7.7 >SB_41219| Best HMM Match : EF1G (HMM E-Value=3.3e-38) Length = 90 Score = 118 bits (284), Expect = 6e-27 Identities = 50/89 (56%), Positives = 70/89 (78%), Gaps = 3/89 (3%) Frame = -2 Query: 691 TFNMDDFKRVYSNED-EAKSIPYFWEKFDPENYSIWYAEYK--YPEELAKVFMSCNLITG 521 + N+D +K+VYSNED E+K+IPYFWE FD E YS+W+ EYK Y ++L VFM+CNL+ G Sbjct: 2 SMNLDAWKKVYSNEDTESKAIPYFWENFDKEGYSLWFLEYKEEYEKDLGMVFMACNLVGG 61 Query: 520 MFQRLDKMRKQAFASVCLFGEDNNSTISG 434 M QRL+K+ K F S+C+FGE++N +I+G Sbjct: 62 MIQRLEKLVKNGFGSICIFGENHNCSIAG 90 >SB_48657| Best HMM Match : GST_C (HMM E-Value=5.8e-07) Length = 203 Score = 52.4 bits (120), Expect = 4e-07 Identities = 24/52 (46%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = -2 Query: 397 LSSDWQVDYESYDWKKLDPSSEETKKLVQDYF-SWNGTDKDGRKFNQGKIFK 245 L+ DW VD SY ++L+P KKL++DYF G+KFNQGK+FK Sbjct: 152 LNEDWNVDAPSYTSRRLNPDDPADKKLIEDYFIQREELTYRGKKFNQGKVFK 203 >SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) Length = 703 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/32 (53%), Positives = 19/32 (59%) Frame = -3 Query: 315 SRTTSRGTEPTKTVESSTRARYSSECRPTSSQ 220 SRT SRG EPTKT S + AR R +S Q Sbjct: 668 SRTLSRGREPTKTSLSKSPARPGVAKRSSSLQ 699 >SB_40630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2174 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = -3 Query: 336 ARRPRNLSRTTS--RGTEPTKTVESSTRARYSSECRPTSSQC 217 ARR + LSR+TS RG+ ++ E S R R +E R +S C Sbjct: 1164 ARRSKQLSRSTSDPRGSLSSERPERSRRRRTETEPRDSSLPC 1205 >SB_24051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 889 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 408 SSFPRHTHTPEMVELLSSPNRQTDAKACLR 497 S+ PR + E + LL P + DA+AC+R Sbjct: 413 SAIPRSRRSFESLPLLQQPTSRRDARACVR 442 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -3 Query: 285 TKTVESSTRARYSSECRP-TSSQCIHISYNNY 193 TK +S+ RA EC T ++CI +SYN+Y Sbjct: 215 TKPTKSNQRAICCDECGQWTHAKCISMSYNSY 246 >SB_28074| Best HMM Match : Helicase_C (HMM E-Value=4.2) Length = 366 Score = 28.7 bits (61), Expect = 5.8 Identities = 20/77 (25%), Positives = 35/77 (45%), Gaps = 4/77 (5%) Frame = -2 Query: 697 KGTFNMDDFKRVYSNEDEAKSIPYFWEKFDPENYS----IWYAEYKYPEELAKVFMSCNL 530 K T +D ++ V+ D ++ DP+NY+ +W E +Y + + F S +L Sbjct: 226 KATDKLDYWESVWKRRDS-------FDAADPDNYNPDQVVWRVELRYHHSIIQQFASGSL 278 Query: 529 ITGMFQRLDKMRKQAFA 479 Q +D +AFA Sbjct: 279 DVRTGQAIDTRSFEAFA 295 >SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) Length = 872 Score = 28.3 bits (60), Expect = 7.7 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = -3 Query: 342 LRARRPRNLSRTTSRGTEPTKTVESSTRA--RYSSECRPTSSQ 220 LR +RPR SR G + ++ + SSEC PTSS+ Sbjct: 595 LREKRPRGQSRENRNGVFVFPSTDNGLQGITSDSSECTPTSSE 637 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,278,312 Number of Sequences: 59808 Number of extensions: 547788 Number of successful extensions: 1751 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1743 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2215746665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -