BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_E14 (755 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q17128 Cluster: Hypertrehalosaemic prohormone precursor... 59 1e-07 UniRef50_P67788 Cluster: Adipokinetic prohormone precursor [Cont... 51 4e-05 UniRef50_A3RE77 Cluster: Adipokinetic hormone 2; n=1; Tribolium ... 46 8e-04 UniRef50_Q5EY02 Cluster: Adipokinetic hormone preproprotein prec... 44 0.003 UniRef50_Q27Q78 Cluster: Adipokinetic hormone I preproprotein; n... 42 0.016 UniRef50_P55319 Cluster: Adipokinetic prohormone type 1 precurso... 41 0.029 UniRef50_A2YEF5 Cluster: Putative uncharacterized protein; n=1; ... 35 2.5 UniRef50_A3TPC4 Cluster: Aminoglycosides/tetracycline-transport ... 33 7.6 >UniRef50_Q17128 Cluster: Hypertrehalosaemic prohormone precursor [Contains: Hypertrehalosaemic hormone (HTH) (Hypertrehalosaemic neuropeptide); Hypertrehalosaemic hormone precursor-related peptide]; n=1; Blaberus discoidalis|Rep: Hypertrehalosaemic prohormone precursor [Contains: Hypertrehalosaemic hormone (HTH) (Hypertrehalosaemic neuropeptide); Hypertrehalosaemic hormone precursor-related peptide] - Blaberus discoidalis (Tropical cockroach) Length = 72 Score = 58.8 bits (136), Expect = 1e-07 Identities = 27/51 (52%), Positives = 35/51 (68%) Frame = -2 Query: 607 CEAQLTFTPGWGQGKRSEATDYRNDGCSSEDSVYTIYKLIKNEAEKFLACQ 455 CEAQ+ F+PGWG GKRS D G S +S+ IYKL++NEA+K L C+ Sbjct: 19 CEAQVNFSPGWGTGKRSAVQDSPCKG--SAESLMYIYKLVQNEAQKILECE 67 >UniRef50_P67788 Cluster: Adipokinetic prohormone precursor [Contains: Adipokinetic hormone (AKH)]; n=1; Manduca sexta|Rep: Adipokinetic prohormone precursor [Contains: Adipokinetic hormone (AKH)] - Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) Length = 65 Score = 50.8 bits (116), Expect = 4e-05 Identities = 24/50 (48%), Positives = 33/50 (66%) Frame = -2 Query: 604 EAQLTFTPGWGQGKRSEATDYRNDGCSSEDSVYTIYKLIKNEAEKFLACQ 455 EAQLTFT WG GKR+ C +++++ IYK I+NEAE+F+ CQ Sbjct: 18 EAQLTFTSSWG-GKRAMTNSI---SCRNDEAIAAIYKAIQNEAERFIMCQ 63 >UniRef50_A3RE77 Cluster: Adipokinetic hormone 2; n=1; Tribolium castaneum|Rep: Adipokinetic hormone 2 - Tribolium castaneum (Red flour beetle) Length = 68 Score = 46.4 bits (105), Expect = 8e-04 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = -2 Query: 607 CEAQLTFTPGWGQGKRSEATDYRNDGCS-SEDSVYTIYKLIKNEAEKFLACQ 455 C AQL FTP WG+ A + ++ C S D++ IYK+I+NEA+K + C+ Sbjct: 17 CAAQLNFTPNWGK----RAPEGESNRCKESVDTIMLIYKIIQNEAQKLVDCE 64 >UniRef50_Q5EY02 Cluster: Adipokinetic hormone preproprotein precursor; n=1; Periplaneta americana|Rep: Adipokinetic hormone preproprotein precursor - Periplaneta americana (American cockroach) Length = 70 Score = 44.4 bits (100), Expect = 0.003 Identities = 25/51 (49%), Positives = 31/51 (60%), Gaps = 1/51 (1%) Frame = -2 Query: 607 CEAQLTFTPGWGQGKRSEATDYRNDGCS-SEDSVYTIYKLIKNEAEKFLAC 458 CEAQLTFTP W GKRS D C S + + IYKL++ EA+K + C Sbjct: 19 CEAQLTFTPNW--GKRSGLQD---GPCKLSTEVLMHIYKLVETEAQKLVEC 64 >UniRef50_Q27Q78 Cluster: Adipokinetic hormone I preproprotein; n=3; Culicidae|Rep: Adipokinetic hormone I preproprotein - Anopheles gambiae (African malaria mosquito) Length = 79 Score = 41.9 bits (94), Expect = 0.016 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 7/56 (12%) Frame = -2 Query: 604 EAQLTFTPGWGQ------GKRSEATDYRNDGCSSE-DSVYTIYKLIKNEAEKFLAC 458 EAQLTFTP WG+ G + + D C + DS+ IY++I+ EA+K + C Sbjct: 21 EAQLTFTPAWGKRSQGAMGINPLGSTFGQDACKTPVDSLLVIYRMIQAEAQKIVDC 76 >UniRef50_P55319 Cluster: Adipokinetic prohormone type 1 precursor [Contains: Adipokinetic hormone 1 (Adipokinetic hormone I) (AKH-I); Adipokinetic hormone precursor-related peptide alpha chain (APRP-alpha) (6 kDa dimeric peptide A)]; n=6; Acrididae|Rep: Adipokinetic prohormone type 1 precursor [Contains: Adipokinetic hormone 1 (Adipokinetic hormone I) (AKH-I); Adipokinetic hormone precursor-related peptide alpha chain (APRP-alpha) (6 kDa dimeric peptide A)] - Locusta migratoria (Migratory locust) Length = 63 Score = 41.1 bits (92), Expect = 0.029 Identities = 22/52 (42%), Positives = 28/52 (53%) Frame = -2 Query: 607 CEAQLTFTPGWGQGKRSEATDYRNDGCSSEDSVYTIYKLIKNEAEKFLACQS 452 C AQL FTP WG GKR +A D+ D +Y+LI+ EA K C + Sbjct: 20 CSAQLNFTPNWGTGKR-DAADF-------ADPYSFLYRLIQAEARKMSGCSN 63 >UniRef50_A2YEF5 Cluster: Putative uncharacterized protein; n=1; Oryza sativa (indica cultivar-group)|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 993 Score = 34.7 bits (76), Expect = 2.5 Identities = 23/50 (46%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +2 Query: 479 FILDQFV--NSINGIFRGASIVSIVGGLRSLALAPTWSKRQLSFADQQGS 622 FIL Q + NSI G+F AS+VSI G A APT R S +GS Sbjct: 665 FILQQLLWRNSIGGVFSNASVVSIEGNDGLCAWAPTKGIRFCSSLADRGS 714 >UniRef50_A3TPC4 Cluster: Aminoglycosides/tetracycline-transport integral membrane protein; n=1; Janibacter sp. HTCC2649|Rep: Aminoglycosides/tetracycline-transport integral membrane protein - Janibacter sp. HTCC2649 Length = 531 Score = 33.1 bits (72), Expect = 7.6 Identities = 15/33 (45%), Positives = 22/33 (66%) Frame = +2 Query: 482 ILDQFVNSINGIFRGASIVSIVGGLRSLALAPT 580 +LD V + +FRGA+I ++VG L S+AL T Sbjct: 491 LLDAAVVQVEWVFRGAAIAAVVGALSSVALGLT 523 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 639,969,099 Number of Sequences: 1657284 Number of extensions: 11676994 Number of successful extensions: 26612 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 25728 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26600 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 62558016040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -