BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_E14 (755 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222289-1|ABN79649.1| 68|Tribolium castaneum adipokinetic hor... 46 2e-07 EF222288-1|ABN79648.1| 73|Tribolium castaneum adipokinetic hor... 31 0.010 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 23 3.5 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 22 4.6 >EF222289-1|ABN79649.1| 68|Tribolium castaneum adipokinetic hormone 2 protein. Length = 68 Score = 46.4 bits (105), Expect = 2e-07 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = -2 Query: 607 CEAQLTFTPGWGQGKRSEATDYRNDGCS-SEDSVYTIYKLIKNEAEKFLACQ 455 C AQL FTP WG+ A + ++ C S D++ IYK+I+NEA+K + C+ Sbjct: 17 CAAQLNFTPNWGK----RAPEGESNRCKESVDTIMLIYKIIQNEAQKLVDCE 64 >EF222288-1|ABN79648.1| 73|Tribolium castaneum adipokinetic hormone 1 protein. Length = 73 Score = 31.1 bits (67), Expect = 0.010 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -2 Query: 607 CEAQLTFTPGWGQGKRSEATDYRNDGCSSEDSVYTIYKLIK 485 C AQL F+ WG+ S A N+ +++ IYK+I+ Sbjct: 17 CTAQLNFSTDWGKRSGSSAGSDANNCKEPVETIMLIYKIIQ 57 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -1 Query: 473 EVSSVPVLNHIEPHRRCSFNQQFVLIPLSNIVK 375 + ++P L ++EP+ R + L L NIVK Sbjct: 96 DYDAIPWLQNVEPNLRPKLLLKHNLFLLDNIVK 128 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 22.2 bits (45), Expect = 4.6 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -3 Query: 87 CXDEXRPTXDGKTRQKERPRT 25 C RP+ GK ++ +PRT Sbjct: 106 CLSLERPSGGGKGKKMRKPRT 126 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,760 Number of Sequences: 336 Number of extensions: 3061 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -