BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_E14 (755 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC26H5.06 |pot1||telomere end-binding protein Pot1 |Schizosacc... 26 5.0 SPAC2F7.11 |nrd1|msa2|RNA-binding protein Nrd1|Schizosaccharomyc... 25 8.8 >SPAC26H5.06 |pot1||telomere end-binding protein Pot1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 555 Score = 26.2 bits (55), Expect = 5.0 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 464 SVPVLNHIEPHRRCSFNQQFV 402 S +L+ I PH+RCSF Q + Sbjct: 200 SFSLLSQITPHQRCSFYAQVI 220 >SPAC2F7.11 |nrd1|msa2|RNA-binding protein Nrd1|Schizosaccharomyces pombe|chr 1|||Manual Length = 529 Score = 25.4 bits (53), Expect = 8.8 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +2 Query: 530 SIVSIVGGLRSLALAPTWSKRQLSFA-DQQGSGQNQHKYQS 649 +I + + ++ L L P WSKR++ + D+ G Q Y S Sbjct: 250 NIAAAIKAVQELPLNPKWSKRRIYYGRDRCAVGLKQPAYFS 290 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,747,207 Number of Sequences: 5004 Number of extensions: 51987 Number of successful extensions: 112 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 361294920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -