BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_E14 (755 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0604 - 19215017-19215101,19215870-19216021,19216591-192166... 28 7.0 03_02_0984 + 12947444-12947530,12949071-12949127,12949833-129499... 28 9.2 >08_02_0604 - 19215017-19215101,19215870-19216021,19216591-19216614, 19216656-19216884,19217061-19217177,19219249-19219311, 19219887-19220125 Length = 302 Score = 28.3 bits (60), Expect = 7.0 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 1/66 (1%) Frame = +2 Query: 473 LCFILDQF-VNSINGIFRGASIVSIVGGLRSLALAPTWSKRQLSFADQQGSGQNQHKYQS 649 L F L+ F + SI G+ + ASI+ +GG ++L + + L D QN+HK S Sbjct: 137 LMFRLEAFKLRSIPGVLKIASILLSIGGTMLISL---YKGKSLHLWDSIIQHQNEHK--S 191 Query: 650 ATHCLQ 667 AT+ L+ Sbjct: 192 ATNQLR 197 >03_02_0984 + 12947444-12947530,12949071-12949127,12949833-12949904, 12950050-12950112,12950955-12951131,12951503-12951628, 12951711-12951777,12952019-12952215,12952617-12952691, 12954524-12954554,12954714-12954802,12955120-12955188, 12955306-12955425,12955963-12956081,12956303-12956441, 12956538-12957038,12957293-12957592,12957694-12957875, 12958277-12958388,12958953-12959072 Length = 900 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 547 RWPPISCPGPNLE*TSAELRRPTRQRTESTQVPKR 651 R+ PISCP P + +S+E+ + + + P+R Sbjct: 235 RFSPISCPPPTISQSSSEIVKGQEKHEADLKYPQR 269 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,429,717 Number of Sequences: 37544 Number of extensions: 298346 Number of successful extensions: 599 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 589 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 599 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2016060588 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -