BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_E14 (755 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g13530.1 68418.m01562 protein kinase family protein / ankyrin... 29 3.3 >At5g13530.1 68418.m01562 protein kinase family protein / ankyrin repeat family protein contains similarity to ankyrin-related gene UNC-44 gi|790608|gb|AAA85854; contains Pfam domains PF00023: Ankyrin repeat and PF00069: Protein kinase domain Length = 834 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -1 Query: 674 EDIEDNGSRFGTCVDSVRCLVGLRSSADVYSRLGPGQEIGGH 549 +D +D+ G+ D R G +S+ + S GP E+G H Sbjct: 93 DDEDDDDEEDGSDEDGARAARGFHASSSINSLCGPVIEVGAH 134 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,786,831 Number of Sequences: 28952 Number of extensions: 255095 Number of successful extensions: 564 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 559 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 564 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1682736544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -