BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_E10 (783 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein p... 28 0.28 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 24 4.6 >AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein protein. Length = 400 Score = 28.3 bits (60), Expect = 0.28 Identities = 29/124 (23%), Positives = 56/124 (45%), Gaps = 6/124 (4%) Frame = -1 Query: 522 GSWKTPSKQKKNFNLPQP------KMANTDLTRLLKSDEIRKVLRAPNKRVIRATRKLNP 361 G K P K+KK +LP+P K N DL ++LK L+ +V + R N Sbjct: 153 GQSKQPKKKKKKRSLPKPEAVVIEKCENIDLAKVLKGLTHDDALKDVGDQVAKVRRTQN- 211 Query: 360 LTNNKAMLKLNPYAAVLKRKAILELRRRKNLKALADAEKSGLKLSKRNPAMKAEKLRERR 181 + +LK A ++ L+ + N++ LA + ++++ + AE++ E Sbjct: 212 -GDMLLVLKRGKEAVRVEAGIKNALKDKANVRTLAPSVM--IEITHLDEITLAEEIAEAL 268 Query: 180 RKNI 169 ++ + Sbjct: 269 KQQL 272 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 24.2 bits (50), Expect = 4.6 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 521 PNKGSSLPNAD*VQMTKRPR*PPGA 595 P G P V M RP+ PPGA Sbjct: 212 PRPGGMYPQPPGVPMPMRPQMPPGA 236 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 644,402 Number of Sequences: 2352 Number of extensions: 12500 Number of successful extensions: 30 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81913191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -