BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_E10 (783 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 27 0.26 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 23 2.4 AJ876408-1|CAI45289.1| 52|Apis mellifera putative diuretic hor... 23 4.2 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 4.2 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 26.6 bits (56), Expect = 0.26 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -1 Query: 480 LPQPKMANTDLTRLLKSDEIRKVLRAPNKRV 388 LP P N L L+ S E+R+ +APN V Sbjct: 490 LPPPYRLNKPLMSLITSSEVRQPGKAPNYSV 520 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 23.4 bits (48), Expect = 2.4 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -1 Query: 582 HLGRFVIWTQSAFGRLDPLFGSWKTPSKQKKNFNLP 475 H + WT ++ P G +KT SK F+LP Sbjct: 25 HRPAWWFWTATSHEASAPAEGKFKTVSKVPGPFSLP 60 >AJ876408-1|CAI45289.1| 52|Apis mellifera putative diuretic hormone-I protein. Length = 52 Score = 22.6 bits (46), Expect = 4.2 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -1 Query: 315 VLKRKAILELRRRKNLKALADAE 247 VL+++ +LEL RRK L+ A + Sbjct: 19 VLRQRVLLELARRKALQDQAQID 41 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 4.2 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 379 YTQIEPAH*QQGDAETQS 326 YT +PA+ QQG A+ Q+ Sbjct: 997 YTPPQPANAQQGQAQAQA 1014 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,078 Number of Sequences: 438 Number of extensions: 2961 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24639531 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -