BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_E09 (365 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_1104 - 10160493-10160599,10160632-10160637,10160930-101609... 27 6.0 07_01_0088 + 684471-685154,685271-685834,685938-686222 26 7.9 04_04_1658 - 35119623-35119754,35121033-35121121,35121205-351215... 26 7.9 02_05_1303 + 35572403-35572624,35572744-35572860,35572987-355731... 26 7.9 >07_01_1104 - 10160493-10160599,10160632-10160637,10160930-10160975, 10161053-10161190,10161275-10161679,10163193-10163330, 10163401-10163482,10163596-10163943,10164294-10164655, 10165154-10165209,10166428-10166558,10166564-10166628, 10169191-10169631 Length = 774 Score = 26.6 bits (56), Expect = 6.0 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +3 Query: 159 INRRQGFIVPAGHSAGDGSPLSTPAGCESELGFGHYEASQNKE*NREFVHFWL 317 +N G++ P +SAGD TP ++ G ASQ+ N + FWL Sbjct: 167 LNLDYGYVYPMFYSAGDLLATGTPKVHVNQKNTGSVNASQDIL-NLDETGFWL 218 >07_01_0088 + 684471-685154,685271-685834,685938-686222 Length = 510 Score = 26.2 bits (55), Expect = 7.9 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = -1 Query: 221 KRAAIAGTVSCRNDESLASIYKLIQNEAEKLLLCQK 114 KR I T+S R+D+ + + + ++++ + LC K Sbjct: 435 KREMIVSTISRRDDDDMETFRDRVDDDSDHVRLCLK 470 >04_04_1658 - 35119623-35119754,35121033-35121121,35121205-35121599, 35122009-35122091,35122163-35124184,35124859-35124927, 35125050-35125130,35125215-35125308,35125435-35125499, 35125961-35126038,35126115-35126360 Length = 1117 Score = 26.2 bits (55), Expect = 7.9 Identities = 18/68 (26%), Positives = 26/68 (38%), Gaps = 8/68 (11%) Frame = -2 Query: 253 PNSLSHPAGVERG--------LPSPALCPAGTMNPWRLFINLFRMKLKNSCYARSLKPTP 98 P+ + HPA V G LP P+ P+RL L+ + C P Sbjct: 932 PSLMDHPAKVMMGWALIAKYHLPQPSSSDQAQTGPYRLVFALYVSTARPDCRQSPSDMAP 991 Query: 97 PKQKHRRK 74 KQ+ + K Sbjct: 992 GKQRGKAK 999 >02_05_1303 + 35572403-35572624,35572744-35572860,35572987-35573112, 35573217-35573279,35573837-35573944,35574587-35574664, 35574772-35574864,35575206-35575292,35575429-35575530, 35575617-35575736,35575839-35575901,35575974-35576119, 35576203-35576296,35576399-35576457,35576568-35576607, 35576694-35576785,35576877-35576946,35578172-35578333, 35578477-35578703,35578863-35579070,35579173-35579258, 35579450-35579541,35579674-35579870 Length = 883 Score = 26.2 bits (55), Expect = 7.9 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -2 Query: 304 TNSRFYSLFWLAS*WPKPNSLSHP 233 T+SR LFW AS W K HP Sbjct: 846 TSSRSSDLFWAASSWLKQLRAYHP 869 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,125,594 Number of Sequences: 37544 Number of extensions: 213509 Number of successful extensions: 601 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 585 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 601 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 564709324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -