SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P01_pT_E07
         (604 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY193728-1|AAO62001.1|  519|Anopheles gambiae cytochrome P450 CY...    25   2.5  
AY062190-1|AAL58551.1|  151|Anopheles gambiae cytochrome P450 CY...    24   3.3  
AY193729-1|AAO62002.1|  499|Anopheles gambiae cytochrome P450 CY...    24   4.4  
AF532982-1|AAQ10289.1|  459|Anopheles gambiae putative RNA methy...    24   4.4  

>AY193728-1|AAO62001.1|  519|Anopheles gambiae cytochrome P450
           CYPm3r5 protein.
          Length = 519

 Score = 24.6 bits (51), Expect = 2.5
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +1

Query: 193 PNVRPEPARYDP 228
           P++ PEPA YDP
Sbjct: 418 PDIYPEPATYDP 429


>AY062190-1|AAL58551.1|  151|Anopheles gambiae cytochrome P450
           CYP4H15 protein.
          Length = 151

 Score = 24.2 bits (50), Expect = 3.3
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +1

Query: 193 PNVRPEPARYDP 228
           P + PEPAR+DP
Sbjct: 111 PELYPEPARFDP 122


>AY193729-1|AAO62002.1|  499|Anopheles gambiae cytochrome P450
           CYPm3r9 protein.
          Length = 499

 Score = 23.8 bits (49), Expect = 4.4
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = +2

Query: 530 TAVLIQTHTLHHANEV 577
           TAV+I  H +HH  EV
Sbjct: 394 TAVMIPVHAIHHDPEV 409


>AF532982-1|AAQ10289.1|  459|Anopheles gambiae putative RNA
           methylase protein.
          Length = 459

 Score = 23.8 bits (49), Expect = 4.4
 Identities = 11/40 (27%), Positives = 19/40 (47%)
 Frame = -3

Query: 218 LAGSGRTFGRPINGQGEIVGVSSQYGAYTDWQASEGLFVH 99
           L  SG     P  G G ++  ++++GAY      + + VH
Sbjct: 214 LVESGHLVFDPFAGSGSLLVAAAKFGAYVAGADIDYMIVH 253


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 639,302
Number of Sequences: 2352
Number of extensions: 13958
Number of successful extensions: 76
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 76
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 76
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 58450473
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -