BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_E05 (757 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19135| Best HMM Match : Ribosomal_L13e (HMM E-Value=0) 207 6e-54 SB_12085| Best HMM Match : TBP (HMM E-Value=3.5e-35) 34 0.14 SB_50893| Best HMM Match : SH3_1 (HMM E-Value=2e-33) 29 3.1 SB_54753| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_47063| Best HMM Match : APOBEC_C (HMM E-Value=0.41) 28 7.1 SB_16060| Best HMM Match : Protamine_P1 (HMM E-Value=7.8) 28 7.1 SB_58892| Best HMM Match : IncA (HMM E-Value=1.3) 28 9.4 SB_32771| Best HMM Match : IncA (HMM E-Value=1.4) 28 9.4 >SB_19135| Best HMM Match : Ribosomal_L13e (HMM E-Value=0) Length = 600 Score = 207 bits (506), Expect = 6e-54 Identities = 102/192 (53%), Positives = 132/192 (68%), Gaps = 2/192 (1%) Frame = -3 Query: 641 KGNNMIPNGHFHKDWQRFVKTWFNQPARRYRRKQNRIXXXXXXXXXXXXXPLRPIVRCPT 462 K NN+IPNGHFHKDWQR+VKTWF+QP R+ RR+ R LRPIVRCPT Sbjct: 4 KRNNIIPNGHFHKDWQRYVKTWFDQPGRKKRRRVARQIKAAKIAPRPVAGSLRPIVRCPT 63 Query: 461 VRYHTKVRAGRGFTLREIRAAGLNPVFARTIGIAVDPRRRNKSVESLQINVQRIKEYRAR 282 +Y+TKVRAGRGFTL E++AAG+ A TIGIAVD RR+N+S ESLQ NVQR+KEY+++ Sbjct: 64 FKYNTKVRAGRGFTLDELKAAGIPRKVAPTIGIAVDHRRKNRSAESLQANVQRLKEYKSK 123 Query: 281 LILFP-KGKKVLKGEANEEERKLATQLRGPLMPVQQPAPKSVARPITEDEKNFKAYQYLR 105 LI+FP K K +G++ + A QL+GP+MP+ Q + ARPITEDEK + + Sbjct: 124 LIVFPRKANKPKQGDSEAADLANAVQLQGPVMPIPQESVPIKARPITEDEKKSASSRQCE 183 Query: 104 GARSI-AKLVGI 72 + + KLVG+ Sbjct: 184 SSGEVKTKLVGL 195 >SB_12085| Best HMM Match : TBP (HMM E-Value=3.5e-35) Length = 440 Score = 33.9 bits (74), Expect = 0.14 Identities = 17/53 (32%), Positives = 27/53 (50%) Frame = -3 Query: 365 IAVDPRRRNKSVESLQINVQRIKEYRARLILFPKGKKVLKGEANEEERKLATQ 207 IA+ R + + + RI+E R ++F GK V G +EE+ KLA + Sbjct: 301 IALQARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSKLAAR 353 >SB_50893| Best HMM Match : SH3_1 (HMM E-Value=2e-33) Length = 665 Score = 29.5 bits (63), Expect = 3.1 Identities = 29/115 (25%), Positives = 47/115 (40%) Frame = -3 Query: 356 DPRRRNKSVESLQINVQRIKEYRARLILFPKGKKVLKGEANEEERKLATQLRGPLMPVQQ 177 +P + ++ E+ + N ++ +E A + K KKVL E+ ++LR Sbjct: 462 EPAWKREAREAREANYKKPEEKVAPSVQHLKDKKVLPVLRPEDILSGKSELRKSWREPDV 521 Query: 176 PAPKSVARPITEDEKNFKAYQYLRGARSIAKLVGIRAKRLKDAAENPDDVTKAPT 12 PAPK P EDE K + G + + K + E P TK+ T Sbjct: 522 PAPKKPVPPPPEDEHK-KPSRPSPPLTKKTNAAGSQEELRKSSREEPPLKTKSVT 575 >SB_54753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 462 Score = 28.7 bits (61), Expect = 5.4 Identities = 18/55 (32%), Positives = 27/55 (49%) Frame = +3 Query: 516 GLSFLYSILLSAVSSSWLVKPSFNKSLPILVEMSIRYHIIPLAHFDVGVLPRQRK 680 G F +IL+ A SS L++P F+ SLP+ + + L H P +RK Sbjct: 195 GFDFGKAILVKASLSSDLIRPGFDVSLPLFPKTHPHKDLGNLPH-SCSAFPLERK 248 >SB_47063| Best HMM Match : APOBEC_C (HMM E-Value=0.41) Length = 430 Score = 28.3 bits (60), Expect = 7.1 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +1 Query: 349 RGSTAIPIVRANTGFNPAALISRRVNPLPAR--TLVWYRTVGHR 474 +GS V ++T NP L++R N +P R +L+W++ G + Sbjct: 375 KGSWVALTVESSTLANPNILLARIQNLMPGRKASLLWFKATGKK 418 >SB_16060| Best HMM Match : Protamine_P1 (HMM E-Value=7.8) Length = 91 Score = 28.3 bits (60), Expect = 7.1 Identities = 21/57 (36%), Positives = 29/57 (50%) Frame = -3 Query: 380 ARTIGIAVDPRRRNKSVESLQINVQRIKEYRARLILFPKGKKVLKGEANEEERKLAT 210 AR I +A+ RR + S+Q + EY R KG+KV KG +ERK A+ Sbjct: 17 ARRIRLAIFSRRLKFARTSVQNRQRNQAEYSER-----KGRKVRKGRKVRKERKPAS 68 >SB_58892| Best HMM Match : IncA (HMM E-Value=1.3) Length = 449 Score = 27.9 bits (59), Expect = 9.4 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +1 Query: 349 RGSTAIPIVRANTGFNPAALISRRVNPLPAR--TLVWYRTVGHRTIGRNGP 495 +GS V +T NP L++R N +P R +L+W++ + + + P Sbjct: 176 KGSWVALTVEGSTLANPNILLARIQNLMPGRKASLLWFKATAEKGLKSDNP 226 >SB_32771| Best HMM Match : IncA (HMM E-Value=1.4) Length = 318 Score = 27.9 bits (59), Expect = 9.4 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +1 Query: 349 RGSTAIPIVRANTGFNPAALISRRVNPLPAR--TLVWYRTVGHRTIGRNGP 495 +GS V +T NP L++R N +P R +L+W++ + + + P Sbjct: 66 KGSWVALTVEGSTLANPNILLARIQNLMPGRKASLLWFKATAEKGLKSDNP 116 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,250,203 Number of Sequences: 59808 Number of extensions: 446973 Number of successful extensions: 1233 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1222 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -