BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_E03 (342 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 23 1.0 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 23 1.0 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 1.8 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 1.8 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 22 2.4 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 21 3.1 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 21 3.1 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 4.1 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 20 7.2 AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 ... 20 9.5 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 23.0 bits (47), Expect = 1.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 161 IYFTCCVLCIFRLLTSWL 108 IY CC+L I ++ WL Sbjct: 248 IYIPCCMLVIVSWVSFWL 265 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 23.0 bits (47), Expect = 1.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 161 IYFTCCVLCIFRLLTSWL 108 IY CC+L I ++ WL Sbjct: 248 IYIPCCMLVIVSWVSFWL 265 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 22.2 bits (45), Expect = 1.8 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = -2 Query: 143 VLCIFRLLTSWLFCLHLLGPIHLLRSLIDNQKAILNAIE 27 ++C+ L+ W CL L P +L+ N +N ++ Sbjct: 282 LICMMLLIGHWSGCLQFLVP--MLQGFPSNSWVAINELQ 318 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 22.2 bits (45), Expect = 1.8 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = -2 Query: 143 VLCIFRLLTSWLFCLHLLGPIHLLRSLIDNQKAILNAIE 27 ++C+ L+ W CL L P +L+ N +N ++ Sbjct: 250 LICMMLLIGHWSGCLQFLVP--MLQGFPSNSWVAINELQ 286 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.8 bits (44), Expect = 2.4 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 Query: 173 SCRCIYFTCCVLCIFRLLTSWL 108 SC+CIY LC+ L +L Sbjct: 182 SCKCIYVQSINLCMAGRLFGYL 203 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 21.4 bits (43), Expect = 3.1 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +1 Query: 154 KYMQRQLGRCRQLGTHTPK 210 +Y Q RC+ +G H P+ Sbjct: 342 RYRQELQKRCKWMGIHEPE 360 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 21.4 bits (43), Expect = 3.1 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +1 Query: 154 KYMQRQLGRCRQLGTHTPK 210 +Y Q RC+ +G H P+ Sbjct: 342 RYRQELQKRCKWMGIHEPE 360 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.0 bits (42), Expect = 4.1 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -2 Query: 242 RCYSCVCCRKAF 207 + Y C+ C+KAF Sbjct: 60 KTYQCLLCQKAF 71 Score = 20.2 bits (40), Expect = 7.2 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = -2 Query: 275 HFNQHVQISAVRCYSCVCCRKAFGV*VPSCLHR 177 H+ H + + Y C C K+F V +HR Sbjct: 110 HYRTH---TGEKPYQCEYCSKSFSVKENLSVHR 139 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 20.2 bits (40), Expect = 7.2 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 Query: 173 WGGVGNWVLIHQRLCGSKRKNSS 241 WGG+G VL L G+ SS Sbjct: 563 WGGIGVVVLFAVVLAGATCLGSS 585 >AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 protein. Length = 208 Score = 19.8 bits (39), Expect = 9.5 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 206 QRLCGSKRKNSSEQQKFE 259 +R G KRK +++KFE Sbjct: 11 RRATGGKRKPIRKKRKFE 28 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 71,068 Number of Sequences: 438 Number of extensions: 1189 Number of successful extensions: 11 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 7839909 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -