BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_E02 (324 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC14G10.02 ||SPCC18B5.13|ribosome biogenesis protein Urb1|Schi... 27 0.93 SPCC191.04c |||dubious|Schizosaccharomyces pombe|chr 3|||Manual 25 2.1 SPAC7D4.11c |sec39||secretory pathway protein Sec39 |Schizosacch... 25 2.1 SPAC1486.04c |alm1||medial ring protein Alm1|Schizosaccharomyces... 24 6.5 SPAC589.12 ||SPAC688.01|glycosylceramide biosynthesis protein |S... 24 6.5 SPAC2G11.02 |urb2||ribosome biogenesis protein Urb2 |Schizosacch... 23 8.6 SPBPJ4664.02 |||glycoprotein |Schizosaccharomyces pombe|chr 2|||... 23 8.6 >SPCC14G10.02 ||SPCC18B5.13|ribosome biogenesis protein Urb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1568 Score = 26.6 bits (56), Expect = 0.93 Identities = 8/32 (25%), Positives = 20/32 (62%) Frame = -3 Query: 136 PYLYLPSTALHSPASTHKAQMQMMRACVNKML 41 P L + ++ H+ + HKA ++ + +C+N+ + Sbjct: 545 PILTILASLQHTSPTQHKAVLEFLNSCINRCI 576 >SPCC191.04c |||dubious|Schizosaccharomyces pombe|chr 3|||Manual Length = 100 Score = 25.4 bits (53), Expect = 2.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 187 CLCRTLQLPATPFPTCHPYLYLP 119 C R +Q PFP H Y ++P Sbjct: 11 CSHRVIQAKHPPFPLFHSYFHIP 33 >SPAC7D4.11c |sec39||secretory pathway protein Sec39 |Schizosaccharomyces pombe|chr 1|||Manual Length = 769 Score = 25.4 bits (53), Expect = 2.1 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -3 Query: 319 EFGRPMSANRVQSNLASDKLSKCL 248 E G+P+S + V++NL DKL K + Sbjct: 517 EPGKPLSPSLVEANLNPDKLIKTI 540 >SPAC1486.04c |alm1||medial ring protein Alm1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1727 Score = 23.8 bits (49), Expect = 6.5 Identities = 14/52 (26%), Positives = 24/52 (46%) Frame = -3 Query: 178 RTLQLPATPFPTCHPYLYLPSTALHSPASTHKAQMQMMRACVNKMLK*RQTV 23 ++ +PAT Y PSTA + + A ++ V+K L+ R+ V Sbjct: 505 KSRNVPATVQVALDEYAQNPSTASETLVNKELANFSSIKEAVSKTLELREKV 556 >SPAC589.12 ||SPAC688.01|glycosylceramide biosynthesis protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 971 Score = 23.8 bits (49), Expect = 6.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 150 FLRVILICTYRLQLCIHRLLPT 85 FL VI I Y+L+ +HRL T Sbjct: 347 FLNVIGIAAYKLEDPVHRLFVT 368 >SPAC2G11.02 |urb2||ribosome biogenesis protein Urb2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1318 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 115 TALHSPASTHKAQMQMMRACVNKML 41 +A+HS AS+ KAQ Q + + +L Sbjct: 175 SAVHSQASSTKAQTQFLHQTLGSIL 199 >SPBPJ4664.02 |||glycoprotein |Schizosaccharomyces pombe|chr 2|||Manual Length = 3971 Score = 23.4 bits (48), Expect = 8.6 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 173 AATAGYPLSYVSSLSVPTVYSSA 105 AATA + + VSS + T Y+SA Sbjct: 170 AATASFSYTNVSSSVIATAYTSA 192 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,240,904 Number of Sequences: 5004 Number of extensions: 22079 Number of successful extensions: 68 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 87815546 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -