BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_D24 (373 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18.03 |||shuttle craft like transcriptional regulator|Schizo... 27 1.2 SPAC1F7.05 |cdc22||ribonucleoside reductase large subunit Cdc22|... 25 3.8 SPBC19F5.02c |||U3 snoRNP protein Utp4 |Schizosaccharomyces pomb... 24 8.8 SPAC29A4.19c |||P-type ATPase |Schizosaccharomyces pombe|chr 1||... 24 8.8 >SPCC18.03 |||shuttle craft like transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 1077 Score = 26.6 bits (56), Expect = 1.2 Identities = 17/50 (34%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = -2 Query: 249 PNSLSHPAGVERGL----PSPALCPAGTMKPWRLFINLFRMKLKNSCYAR 112 P+S P G RG P P LC G P + F + K S +AR Sbjct: 275 PHSCGDPCGKTRGQDCEHPCPLLCHPGPCPPCTATVEKFCLCGKESIHAR 324 >SPAC1F7.05 |cdc22||ribonucleoside reductase large subunit Cdc22|Schizosaccharomyces pombe|chr 1|||Manual Length = 811 Score = 25.0 bits (52), Expect = 3.8 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 359 RPMISSCFEVTQRTNSAKNV 300 RP +SSCF VT + +S + + Sbjct: 212 RPQLSSCFLVTMKDDSIEGI 231 >SPBC19F5.02c |||U3 snoRNP protein Utp4 |Schizosaccharomyces pombe|chr 2|||Manual Length = 710 Score = 23.8 bits (49), Expect = 8.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 128 TPAMPEALSRHHRNGNTDKMPFN 60 TP+ A++ H++G D MP N Sbjct: 12 TPSAITAMAFSHKSGQNDSMPNN 34 >SPAC29A4.19c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1096 Score = 23.8 bits (49), Expect = 8.8 Identities = 10/26 (38%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -1 Query: 340 VSKSLKELTQPKMYKFTILFL-VLAC 266 +S+ L+ P +Y+F ILF+ V++C Sbjct: 1063 ISRCLQITRLPTLYRFIILFMGVISC 1088 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,602,617 Number of Sequences: 5004 Number of extensions: 32171 Number of successful extensions: 72 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 118158644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -