BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_D24 (373 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ388479-1|ABD43194.1| 79|Anopheles gambiae adipokinetic hormo... 42 6e-06 EF519477-2|ABP73564.1| 177|Anopheles gambiae CTL4 protein. 25 1.2 AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylch... 23 2.8 U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. 23 3.7 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 23 3.7 AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phospho... 23 4.9 >DQ388479-1|ABD43194.1| 79|Anopheles gambiae adipokinetic hormone I preproprotein protein. Length = 79 Score = 42.3 bits (95), Expect = 6e-06 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 10/72 (13%) Frame = -1 Query: 295 FTILFLVLACFIMAEAQLTFTSSWGGKR---------AAIAGTVSCRND-EALASIYKLI 146 FT+L + + ++ EAQLTFT +WG + + G +C+ ++L IY++I Sbjct: 7 FTVLLICASLMLITEAQLTFTPAWGKRSQGAMGINPLGSTFGQDACKTPVDSLLVIYRMI 66 Query: 145 QNEAEKLLLCQK 110 Q EA+K++ C + Sbjct: 67 QAEAQKIVDCSQ 78 >EF519477-2|ABP73564.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 24.6 bits (51), Expect = 1.2 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +3 Query: 225 QLDVKVSWASAIMKQAKTRNRIVNLYIFG*VSSLSDFETATDHRPAEFI 371 Q+ WA + A NR+V ++ S++S T+ D P +FI Sbjct: 129 QVKESAEWADGV---APANNRVVPFCVYIQGSTMSWVATSCDDEPRQFI 174 >AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 5 protein. Length = 533 Score = 23.4 bits (48), Expect = 2.8 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 107 LSRHHRNGNTDKMPFNHYIIFS*SLKCI 24 L+ HHRN +T +M +IF L CI Sbjct: 331 LNYHHRNADTHEMSDWVRVIFLYWLPCI 358 >U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. Length = 140 Score = 23.0 bits (47), Expect = 3.7 Identities = 18/54 (33%), Positives = 26/54 (48%) Frame = -1 Query: 295 FTILFLVLACFIMAEAQLTFTSSWGGKRAAIAGTVSCRNDEALASIYKLIQNEA 134 FT+L ++AC +AEA+ TF K A G +L L+QNE+ Sbjct: 5 FTVLLAIVACCAVAEAK-TFGKCELAKALANNGIAKA----SLPDWVCLVQNES 53 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 3.7 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -2 Query: 195 LCPAGTMKPWRLFINLFRMKLKNS 124 LC KPW L N K+K+S Sbjct: 336 LCDEIARKPWGLAFNTLMNKVKSS 359 >AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phosphoribosyltransferase-like protein protein. Length = 519 Score = 22.6 bits (46), Expect = 4.9 Identities = 9/28 (32%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -1 Query: 193 VSCRNDEALASIYKLIQ-NEAEKLLLCQ 113 V+C+ AL +YK+++ N ++ L Q Sbjct: 358 VTCQRQPALGCVYKMVEINNQPRIKLSQ 385 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 399,539 Number of Sequences: 2352 Number of extensions: 8028 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 28374390 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -