BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_D24 (373 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g02475.1 68414.m00198 expressed protein 30 0.56 At1g04550.2 68414.m00448 auxin-responsive protein / indoleacetic... 29 1.3 At5g38400.1 68418.m04642 hypothetical protein 27 5.3 At5g48060.1 68418.m05938 C2 domain-containing protein contains I... 26 7.0 At4g38190.1 68417.m05391 cellulose synthase family protein simil... 26 9.2 At1g28280.1 68414.m03471 VQ motif-containing protein contains PF... 26 9.2 >At1g02475.1 68414.m00198 expressed protein Length = 219 Score = 29.9 bits (64), Expect = 0.56 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 168 WRLFINLFRMKLKNSCYARSLKPTPPKRKH 79 W L N F +K S AR+L+PTP ++ H Sbjct: 124 WSLKYNAFGQDIKYSWLARNLQPTPNQKIH 153 >At1g04550.2 68414.m00448 auxin-responsive protein / indoleacetic acid-induced protein 12 (IAA12) identical to SP|Q38830 Auxin-responsive protein IAA12 (Indoleacetic acid-induced protein 12) {Arabidopsis thaliana} Length = 239 Score = 28.7 bits (61), Expect = 1.3 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -2 Query: 171 PWRLFIN-LFRMKLKNSCYARSLKPTPPKRKHRQ 73 PWR+FIN + R+++ + A L P ++K RQ Sbjct: 201 PWRMFINSVKRLRIMGTSEASGLAPRRQEQKDRQ 234 >At5g38400.1 68418.m04642 hypothetical protein Length = 151 Score = 26.6 bits (56), Expect = 5.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -2 Query: 138 KLKNSCYARSLKPTPPKRK 82 K + + Y S+KP PPKRK Sbjct: 42 KARMNVYKESMKPLPPKRK 60 >At5g48060.1 68418.m05938 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1036 Score = 26.2 bits (55), Expect = 7.0 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +3 Query: 219 PPQLDVKVSWASAI 260 PP +D+K+SWA A+ Sbjct: 903 PPHMDMKLSWAEAV 916 >At4g38190.1 68417.m05391 cellulose synthase family protein similar to cellulose synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-5 (gi:9622882) from Zea mays Length = 1111 Score = 25.8 bits (54), Expect = 9.2 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -1 Query: 304 MYKFTILFLVLACFIMA 254 +Y FT LFL+L CF+ A Sbjct: 885 IYPFTSLFLILYCFLPA 901 >At1g28280.1 68414.m03471 VQ motif-containing protein contains PF05678: VQ motif Length = 247 Score = 25.8 bits (54), Expect = 9.2 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -3 Query: 347 SSCFEVTQRTNSAKNVQIHDSIPCFGLLHNGRSP 246 +S F + +R NS KN++I+ P F +++ SP Sbjct: 123 ASGFRLYERRNSMKNLKINPLNPVFNPVNSAFSP 156 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,385,433 Number of Sequences: 28952 Number of extensions: 173268 Number of successful extensions: 404 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 395 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 404 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 497853200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -