BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_D21 (762 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 22 6.1 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 22 6.1 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 743 KLTKKNXFLIFSTKIIVFFSYGNIRL 666 KLT + +I TKI FS G +++ Sbjct: 85 KLTNRESSIIDKTKISFNFSQGPVKI 110 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 21.8 bits (44), Expect = 6.1 Identities = 11/54 (20%), Positives = 25/54 (46%) Frame = -1 Query: 744 ETNKKKXLSHFFHKNNRVFFVWQH*IIHDSFKSST*RSFLNQYSKCTFKI*IHD 583 + +K + H + NN ++ + I++S + S + +LN + + HD Sbjct: 28 DCDKNQNTEHNYTHNNEMYHSVKEEPIYESCRFSINQPYLNHFDNSVTPMVNHD 81 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,867 Number of Sequences: 336 Number of extensions: 2776 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20442493 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -