BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_D21 (762 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50088| Best HMM Match : RanGAP1_C (HMM E-Value=0.001) 28 9.5 >SB_50088| Best HMM Match : RanGAP1_C (HMM E-Value=0.001) Length = 636 Score = 27.9 bits (59), Expect = 9.5 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -3 Query: 718 SFFPQK*SCFFRMATLDYPRLVQVKHLEILSKSV 617 S+FPQ +CFF +A L P +H E+L K++ Sbjct: 469 SYFPQSLTCFF-VAFLTKPNTRLSQHPELLKKAL 501 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,811,470 Number of Sequences: 59808 Number of extensions: 285949 Number of successful extensions: 293 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 281 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 293 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2082369341 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -