BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_D21 (762 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 24 5.9 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 24 5.9 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 23.8 bits (49), Expect = 5.9 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = -2 Query: 707 TKIIVFFSYGNIRLSTTRSSQALRDPF*ISIQNAHLKFKYMIKGFL 570 T ++VF + GN+ + + + + +R I+I AHL ++ FL Sbjct: 55 TTLMVFSATGNLTVLSILAQRKVRASSRINIMLAHLAIADLLVTFL 100 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 23.8 bits (49), Expect = 5.9 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = -2 Query: 707 TKIIVFFSYGNIRLSTTRSSQALRDPF*ISIQNAHLKFKYMIKGFL 570 T ++VF + GN+ + + + + +R I+I AHL ++ FL Sbjct: 55 TTLMVFSATGNLTVLSILAQRKVRASSRINIMLAHLAIADLLVTFL 100 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 614,847 Number of Sequences: 2352 Number of extensions: 10314 Number of successful extensions: 47 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 47 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -