BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_D21 (762 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 23 4.1 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 23 4.1 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 23 4.1 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 7.1 AY340960-1|AAQ16586.1| 78|Apis mellifera apisimin precursor pr... 21 9.4 AY055108-1|AAL15544.1| 78|Apis mellifera apisimin precursor pr... 21 9.4 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 236 LVLHPVLKAGEA*QFIQSFGQCSSVSKKFDGF 331 ++LH AG+A FI G S+ +KF G+ Sbjct: 1 MLLHNKTLAGKALAFIAEEGYVPSMREKFLGW 32 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 22.6 bits (46), Expect = 4.1 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -2 Query: 731 KNXFLIFSTKIIVFFSYGNIRLSTTR 654 +N L+ KI++ YG+I S T+ Sbjct: 11 QNVVLVKKVKIVLLIFYGSIMFSMTQ 36 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 236 LVLHPVLKAGEA*QFIQSFGQCSSVSKKFDGF 331 ++LH AG+A FI G S+ +KF G+ Sbjct: 1 MLLHNKTLAGKALAFIAEEGYVPSMREKFLGW 32 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/49 (18%), Positives = 21/49 (42%) Frame = -2 Query: 305 YYIGQKIE*IVKPHQLSILGVELEISNNYFLEFQSQRNKS*LSILSMTF 159 YY+G ++ KP+ + E + L+ + + + S++ F Sbjct: 1012 YYVGYRLSSSEKPYMFETVDFSKEDGKEHHLQIMNLKTYTQYSVVVQAF 1060 >AY340960-1|AAQ16586.1| 78|Apis mellifera apisimin precursor protein. Length = 78 Score = 21.4 bits (43), Expect = 9.4 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 352 LTRMTQVNRLSIRLDANLF 408 L T VN L I +DAN+F Sbjct: 59 LLAQTLVNILQILIDANVF 77 >AY055108-1|AAL15544.1| 78|Apis mellifera apisimin precursor protein. Length = 78 Score = 21.4 bits (43), Expect = 9.4 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 352 LTRMTQVNRLSIRLDANLF 408 L T VN L I +DAN+F Sbjct: 59 LLAQTLVNILQILIDANVF 77 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,418 Number of Sequences: 438 Number of extensions: 3187 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23789892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -