BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_D20 (507 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY040367-1|AAK91776.1| 215|Homo sapiens interleukin 19 protein. 30 4.0 AL513315-2|CAH71814.1| 215|Homo sapiens interleukin 19 protein. 30 4.0 AF453946-1|AAN40906.1| 177|Homo sapiens interleukin 19 protein. 30 4.0 AF390905-1|AAK64498.1| 177|Homo sapiens interleukin 19 protein. 30 4.0 AF276915-1|AAG16755.1| 177|Homo sapiens interleukin-19 protein. 30 4.0 AF192498-1|AAF06663.1| 177|Homo sapiens melanoma differentiatio... 30 4.0 >AY040367-1|AAK91776.1| 215|Homo sapiens interleukin 19 protein. Length = 215 Score = 30.3 bits (65), Expect = 4.0 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -2 Query: 104 HQEWSAKSLQIISXLSNDTIYFEKWVRPPQEQ 9 HQE + K L+ IS ++N +Y +K +R QEQ Sbjct: 131 HQEPNPKILRKISSIANSFLYMQKTLRQCQEQ 162 >AL513315-2|CAH71814.1| 215|Homo sapiens interleukin 19 protein. Length = 215 Score = 30.3 bits (65), Expect = 4.0 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -2 Query: 104 HQEWSAKSLQIISXLSNDTIYFEKWVRPPQEQ 9 HQE + K L+ IS ++N +Y +K +R QEQ Sbjct: 131 HQEPNPKILRKISSIANSFLYMQKTLRQCQEQ 162 >AF453946-1|AAN40906.1| 177|Homo sapiens interleukin 19 protein. Length = 177 Score = 30.3 bits (65), Expect = 4.0 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -2 Query: 104 HQEWSAKSLQIISXLSNDTIYFEKWVRPPQEQ 9 HQE + K L+ IS ++N +Y +K +R QEQ Sbjct: 93 HQEPNPKILRKISSIANSFLYMQKTLRQCQEQ 124 >AF390905-1|AAK64498.1| 177|Homo sapiens interleukin 19 protein. Length = 177 Score = 30.3 bits (65), Expect = 4.0 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -2 Query: 104 HQEWSAKSLQIISXLSNDTIYFEKWVRPPQEQ 9 HQE + K L+ IS ++N +Y +K +R QEQ Sbjct: 93 HQEPNPKILRKISSIANSFLYMQKTLRQCQEQ 124 >AF276915-1|AAG16755.1| 177|Homo sapiens interleukin-19 protein. Length = 177 Score = 30.3 bits (65), Expect = 4.0 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -2 Query: 104 HQEWSAKSLQIISXLSNDTIYFEKWVRPPQEQ 9 HQE + K L+ IS ++N +Y +K +R QEQ Sbjct: 93 HQEPNPKILRKISSIANSFLYMQKTLRQCQEQ 124 >AF192498-1|AAF06663.1| 177|Homo sapiens melanoma differentiation associated protein-like protein protein. Length = 177 Score = 30.3 bits (65), Expect = 4.0 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -2 Query: 104 HQEWSAKSLQIISXLSNDTIYFEKWVRPPQEQ 9 HQE + K L+ IS ++N +Y +K +R QEQ Sbjct: 93 HQEPNPKILRKISSIANSFLYMQKTLRQCQEQ 124 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,247,467 Number of Sequences: 237096 Number of extensions: 1296519 Number of successful extensions: 2152 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2152 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4706589866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -