SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P01_pT_D19
         (692 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g17860.1 68418.m02093 cation exchanger, putative (CAX7) conta...    30   1.3  

>At5g17860.1 68418.m02093 cation exchanger, putative (CAX7) contains
           similarity to SWISS-PROT:Q9HC58 NKX3_HUMAN
           Sodium/potassium/calcium exchanger 3 precursor {Homo
           sapiens}; Ca2+:Cation Antiporter (CaCA) Family member
           PMID:11500563
          Length = 570

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 3/47 (6%)
 Frame = -3

Query: 525 SKVSFLV*KGLSGPRFLVDFIFFFCCIFNVACVL-HIIY--FIFVIF 394
           SK S++  +   GP+  +D++  F CIF  + VL H++   ++FV+F
Sbjct: 67  SKCSYIRSQSKCGPQGYIDYLKIFFCIFGQSPVLGHLVLSAWLFVLF 113


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,356,853
Number of Sequences: 28952
Number of extensions: 225082
Number of successful extensions: 399
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 394
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 399
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1477286152
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -