BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_D18 (531 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 8e-10 SB_32212| Best HMM Match : Histone (HMM E-Value=9.4e-33) 54 5e-08 SB_56326| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_54197| Best HMM Match : Histone (HMM E-Value=9.4e-33) 53 2e-07 SB_48204| Best HMM Match : Histone (HMM E-Value=2.7e-32) 53 2e-07 SB_32396| Best HMM Match : Histone (HMM E-Value=9.4e-33) 53 2e-07 SB_31835| Best HMM Match : Histone (HMM E-Value=9.4e-33) 53 2e-07 SB_29633| Best HMM Match : Histone (HMM E-Value=5.3e-31) 53 2e-07 SB_28838| Best HMM Match : Histone (HMM E-Value=9.4e-33) 53 2e-07 SB_14747| Best HMM Match : Histone (HMM E-Value=9.4e-33) 53 2e-07 SB_54382| Best HMM Match : Histone (HMM E-Value=9.4e-33) 53 2e-07 SB_45182| Best HMM Match : Histone (HMM E-Value=9.4e-33) 53 2e-07 SB_42476| Best HMM Match : Histone (HMM E-Value=9.4e-33) 53 2e-07 SB_25226| Best HMM Match : Histone (HMM E-Value=9.4e-33) 53 2e-07 SB_19336| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_11028| Best HMM Match : Histone (HMM E-Value=9.4e-33) 53 2e-07 SB_9842| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_8583| Best HMM Match : Histone (HMM E-Value=9.4e-33) 53 2e-07 SB_8319| Best HMM Match : Histone (HMM E-Value=9.4e-33) 53 2e-07 SB_7498| Best HMM Match : Histone (HMM E-Value=9.4e-33) 53 2e-07 SB_54557| Best HMM Match : PHK_AB (HMM E-Value=0) 52 4e-07 SB_3888| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_56156| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 9e-07 SB_55462| Best HMM Match : Histone (HMM E-Value=4.8e-33) 50 9e-07 SB_46252| Best HMM Match : Histone (HMM E-Value=4.8e-33) 50 9e-07 SB_5065| Best HMM Match : Histone (HMM E-Value=2.6e-33) 50 9e-07 SB_1105| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 9e-07 SB_54707| Best HMM Match : Histone (HMM E-Value=9.4e-33) 50 9e-07 SB_31727| Best HMM Match : Histone (HMM E-Value=5e-33) 50 9e-07 SB_31723| Best HMM Match : Histone (HMM E-Value=0.016) 50 9e-07 SB_28189| Best HMM Match : Histone (HMM E-Value=1.5e-12) 50 9e-07 SB_26809| Best HMM Match : Histone (HMM E-Value=4.8e-33) 50 9e-07 SB_25701| Best HMM Match : Histone (HMM E-Value=4.8e-33) 50 9e-07 SB_24673| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 9e-07 SB_18628| Best HMM Match : Histone (HMM E-Value=1.5e-31) 50 9e-07 SB_55892| Best HMM Match : Histone (HMM E-Value=9.4e-33) 50 2e-06 SB_1956| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_57971| Best HMM Match : Histone (HMM E-Value=5.4e-33) 49 2e-06 SB_38873| Best HMM Match : Histone (HMM E-Value=2.6e-33) 49 2e-06 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 40 0.001 SB_50166| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.016 SB_58451| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_38686| Best HMM Match : 7tm_1 (HMM E-Value=5.70048e-42) 29 2.4 SB_20073| Best HMM Match : F5_F8_type_C (HMM E-Value=2.9e-18) 29 2.4 SB_27184| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-05) 28 5.4 SB_16639| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_25269| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_35405| Best HMM Match : TraI (HMM E-Value=2.1) 27 9.5 SB_8792| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_4675| Best HMM Match : DUF842 (HMM E-Value=1.5) 27 9.5 SB_30541| Best HMM Match : PSI_PsaJ (HMM E-Value=4) 27 9.5 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 60.5 bits (140), Expect = 8e-10 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -3 Query: 529 KXITPRHLQLAIRGDEELDSLIKATIAXGGV 437 K ITPRHLQLAIRGDEELDSLIKATIA GGV Sbjct: 150 KRITPRHLQLAIRGDEELDSLIKATIAGGGV 180 >SB_32212| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 54.4 bits (125), Expect = 5e-08 Identities = 27/42 (64%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ ATIA GGV+P+I SL+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGATIAQGGVLPNIQASLLPKK 119 >SB_56326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 54.0 bits (124), Expect = 7e-08 Identities = 26/46 (56%), Positives = 33/46 (71%), Gaps = 1/46 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKKXGPG 389 I PRHLQLA+R DEEL+ L++ TIA GGV+P+I L+ KK G Sbjct: 42 IVPRHLQLAVRNDEELNKLLQGVTIAQGGVLPNIQAVLLPKKSNTG 87 >SB_54197| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 52.8 bits (121), Expect = 2e-07 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_48204| Best HMM Match : Histone (HMM E-Value=2.7e-32) Length = 125 Score = 52.8 bits (121), Expect = 2e-07 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_32396| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 52.8 bits (121), Expect = 2e-07 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_31835| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 52.8 bits (121), Expect = 2e-07 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_29633| Best HMM Match : Histone (HMM E-Value=5.3e-31) Length = 125 Score = 52.8 bits (121), Expect = 2e-07 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_28838| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 52.8 bits (121), Expect = 2e-07 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_14747| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 52.8 bits (121), Expect = 2e-07 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_54382| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 52.8 bits (121), Expect = 2e-07 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_45182| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 52.8 bits (121), Expect = 2e-07 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_42476| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 52.8 bits (121), Expect = 2e-07 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_25226| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 52.8 bits (121), Expect = 2e-07 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_19336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 52.8 bits (121), Expect = 2e-07 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_11028| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 52.8 bits (121), Expect = 2e-07 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_9842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 52.8 bits (121), Expect = 2e-07 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_8583| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 52.8 bits (121), Expect = 2e-07 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_8319| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 52.8 bits (121), Expect = 2e-07 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_7498| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 52.8 bits (121), Expect = 2e-07 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_54557| Best HMM Match : PHK_AB (HMM E-Value=0) Length = 863 Score = 51.6 bits (118), Expect = 4e-07 Identities = 25/42 (59%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L++ TIA GGV+P+I L+ KK Sbjct: 815 IIPRHLQLAVRNDEELNRLLRGVTIAQGGVLPNIQAVLLPKK 856 >SB_3888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 986 Score = 51.6 bits (118), Expect = 4e-07 Identities = 24/44 (54%), Positives = 31/44 (70%), Gaps = 1/44 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKKXG 395 I PRH+ LA+ DEEL L+K TIA GGV+P+IH L+ K+ G Sbjct: 713 IIPRHILLAVANDEELHKLLKGVTIASGGVLPNIHPELLKKRKG 756 >SB_56156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 50.4 bits (115), Expect = 9e-07 Identities = 25/42 (59%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_55462| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 126 Score = 50.4 bits (115), Expect = 9e-07 Identities = 25/42 (59%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_46252| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 134 Score = 50.4 bits (115), Expect = 9e-07 Identities = 25/42 (59%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 86 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 127 >SB_5065| Best HMM Match : Histone (HMM E-Value=2.6e-33) Length = 330 Score = 50.4 bits (115), Expect = 9e-07 Identities = 25/42 (59%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_1105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 50.4 bits (115), Expect = 9e-07 Identities = 25/42 (59%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 448 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 489 >SB_54707| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 126 Score = 50.4 bits (115), Expect = 9e-07 Identities = 25/42 (59%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_31727| Best HMM Match : Histone (HMM E-Value=5e-33) Length = 126 Score = 50.4 bits (115), Expect = 9e-07 Identities = 25/42 (59%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_31723| Best HMM Match : Histone (HMM E-Value=0.016) Length = 76 Score = 50.4 bits (115), Expect = 9e-07 Identities = 25/42 (59%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 28 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 69 >SB_28189| Best HMM Match : Histone (HMM E-Value=1.5e-12) Length = 90 Score = 50.4 bits (115), Expect = 9e-07 Identities = 25/42 (59%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 42 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 83 >SB_26809| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 126 Score = 50.4 bits (115), Expect = 9e-07 Identities = 25/42 (59%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_25701| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 126 Score = 50.4 bits (115), Expect = 9e-07 Identities = 25/42 (59%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_24673| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 50.4 bits (115), Expect = 9e-07 Identities = 25/42 (59%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_18628| Best HMM Match : Histone (HMM E-Value=1.5e-31) Length = 126 Score = 50.4 bits (115), Expect = 9e-07 Identities = 25/42 (59%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_55892| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 49.6 bits (113), Expect = 2e-06 Identities = 25/42 (59%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA G V+P+I SL+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTIAQGRVLPNIQASLLPKK 119 >SB_1956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 49.2 bits (112), Expect = 2e-06 Identities = 24/42 (57%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLI-KATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 78 IIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKR 119 >SB_57971| Best HMM Match : Histone (HMM E-Value=5.4e-33) Length = 125 Score = 49.2 bits (112), Expect = 2e-06 Identities = 24/42 (57%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TI+ GGV+P+I L+ KK Sbjct: 78 IIPRHLQLAVRNDEELNRLLHGVTISQGGVLPNIQAVLLPKK 119 >SB_38873| Best HMM Match : Histone (HMM E-Value=2.6e-33) Length = 125 Score = 49.2 bits (112), Expect = 2e-06 Identities = 24/42 (57%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLI-KATIAXGGVIPHIHKSLIGKK 401 I PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 78 IIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKR 119 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/30 (66%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIK-ATIAXGGV 437 I PRHLQLA+R DEEL+ L+ TIA GGV Sbjct: 25 IIPRHLQLAVRNDEELNRLLHGVTIAQGGV 54 >SB_50166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 36.3 bits (80), Expect = 0.016 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 502 LAIRGDEELDSLIKA-TIAXGGVIPHIHKSLIGKK 401 LA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 1 LAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKR 35 >SB_58451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 495 Score = 30.7 bits (66), Expect = 0.77 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +3 Query: 117 FKCPMNKQKLSLILIQSYFKSPYSLHISITYSYIFSPDQQF-QSHHCPLH 263 F P + L S F P+S+ ISI S +++ +QF Q HH +H Sbjct: 295 FGTPSKDNGFTSFLFVSSFVIPFSILISIYLSILWTARKQFRQVHHAKIH 344 >SB_38686| Best HMM Match : 7tm_1 (HMM E-Value=5.70048e-42) Length = 366 Score = 29.1 bits (62), Expect = 2.4 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -1 Query: 459 QLSLXEASSHTYTNLSLERKXVLVHPFNFKL 367 Q +L S T+T ++LER ++HPF KL Sbjct: 119 QDALVSVSVFTFTAIALERYRAIIHPFKPKL 149 >SB_20073| Best HMM Match : F5_F8_type_C (HMM E-Value=2.9e-18) Length = 593 Score = 29.1 bits (62), Expect = 2.4 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = -3 Query: 523 ITPRHLQLAIRGDEELDSLIKATIAXGGVIPHIHKSLIGKKXGPG 389 +T +H+ + R + LIK + G H+H+ L G++ G Sbjct: 207 LTAKHINITNRTANVVKKLIKIGLLTNGSTTHVHRFLKGQRNNTG 251 >SB_27184| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-05) Length = 170 Score = 27.9 bits (59), Expect = 5.4 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = -1 Query: 450 LXEASSHTYTNLSLERKXVLVHP--FNFKL*DDKI 352 L ASS T T L++ER +VHP FKL D + Sbjct: 91 LTTASSFTLTVLAVERYQAIVHPMCMRFKLRDGAV 125 >SB_16639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = -1 Query: 459 QLSLXEASSHTYTNLSLERKXVLVHPFNFKL*DDKIIL 346 Q +L S +T+ ++LER +++PF KL K+++ Sbjct: 115 QDALVSVSVYTFVVIALERYRAIINPFKPKLSKSKVLI 152 >SB_25269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 871 Score = 27.9 bits (59), Expect = 5.4 Identities = 17/59 (28%), Positives = 24/59 (40%), Gaps = 3/59 (5%) Frame = +2 Query: 302 GDDLCRCVTTAGIKCSIILSSHNLKLNGCTRTXFLSNERFVYVWDDAS---XSDSCFYE 469 G CR + T G +C ++ S K N C F + F + +A DSC E Sbjct: 632 GSITCRIIKTVGDRCLDLVPSRIFKHNSCGIALFQNTYMFFFEGSNADCFPVHDSCAKE 690 >SB_35405| Best HMM Match : TraI (HMM E-Value=2.1) Length = 332 Score = 27.1 bits (57), Expect = 9.5 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -1 Query: 108 CNWWDMHSSVIVVHCTDLYLSLTDCDTI 25 C WD+ V+ HCT L S C ++ Sbjct: 18 CRRWDVFLQVVRAHCTALRQSRRSCKSL 45 >SB_8792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1045 Score = 27.1 bits (57), Expect = 9.5 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = +3 Query: 84 CYAYPTSYIQNFKCPMNKQKLSLILIQSYFKSPYSLHISI 203 C Y T YI++ CP + I + F+ P + + S+ Sbjct: 705 CGEYDTEYIESGVCPQTESMSQAISLNGSFQRPSTSNTSV 744 >SB_4675| Best HMM Match : DUF842 (HMM E-Value=1.5) Length = 160 Score = 27.1 bits (57), Expect = 9.5 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 3/33 (9%) Frame = +3 Query: 66 SELQ*HCYAYPTSY---IQNFKCPMNKQKLSLI 155 SEL+ H Y PTSY I FK +NK++ ++ Sbjct: 109 SELKRHNYVTPTSYLELISTFKALLNKKQQEVV 141 >SB_30541| Best HMM Match : PSI_PsaJ (HMM E-Value=4) Length = 368 Score = 27.1 bits (57), Expect = 9.5 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 439 VIPHIHKSLIGKKXG 395 V PH+HK+L+G K G Sbjct: 37 VFPHLHKALLGAKAG 51 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,184,172 Number of Sequences: 59808 Number of extensions: 305121 Number of successful extensions: 640 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 527 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 600 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1191330434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -