BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_D17 (721 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 23 2.9 AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 23 2.9 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 2.9 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 23 3.8 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 23 3.8 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 23 3.8 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 8.9 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 23.0 bits (47), Expect = 2.9 Identities = 6/12 (50%), Positives = 11/12 (91%) Frame = -1 Query: 238 ILSFFICWAWYY 203 +++FFICWA ++ Sbjct: 266 VITFFICWAPFH 277 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -1 Query: 238 ILSFFICWAWYY 203 I FFICW YY Sbjct: 266 IAVFFICWTPYY 277 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 Query: 287 CWWPYCLWSHWLG*DLNT 234 CW PY + S W D N+ Sbjct: 272 CWTPYYVMSLWYWIDRNS 289 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.0 bits (47), Expect = 2.9 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 280 HQHYQWSYLAHGHRVPSHQGQHG 348 HQH+ Y H HR S QHG Sbjct: 319 HQHHPSQY--HPHRGSSPHHQHG 339 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 22.6 bits (46), Expect = 3.8 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 30 IKKNFITSYRLTTTTDYAYIFSLSDR 107 IK+N S R+ T Y+ +LSDR Sbjct: 357 IKQNVPQSGRVNNTQRNEYLLALSDR 382 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 22.6 bits (46), Expect = 3.8 Identities = 6/12 (50%), Positives = 11/12 (91%) Frame = -1 Query: 238 ILSFFICWAWYY 203 +++FFICWA ++ Sbjct: 291 VVAFFICWAPFH 302 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -1 Query: 262 VIGLAKI*ILSFFICWAWYY 203 VI + ++ FFICWA ++ Sbjct: 268 VIKMLSAVVILFFICWAPFH 287 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 8.9 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +1 Query: 178 KNHEVTKYCSTKPNI*KMKVFKS*PSQ*LH 267 K HE T C KP + ++K+ LH Sbjct: 2 KEHEATGTCQKKPTKLRNLIYKTEAFDSLH 31 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,295 Number of Sequences: 438 Number of extensions: 3980 Number of successful extensions: 14 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -