BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_D14 (302 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23131| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.10 SB_59058| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.95 SB_51975| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.95 SB_12488| Best HMM Match : PAN (HMM E-Value=0.0087) 28 1.3 SB_7587| Best HMM Match : zf-C2H2 (HMM E-Value=3.5e-13) 28 1.3 SB_57006| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.2 SB_56509| Best HMM Match : Ebp2 (HMM E-Value=2.1) 27 2.2 SB_35194| Best HMM Match : EGF_2 (HMM E-Value=0) 27 2.9 SB_50779| Best HMM Match : DUF885 (HMM E-Value=1.4e-17) 26 5.1 SB_148| Best HMM Match : PRKCSH (HMM E-Value=2.4) 26 5.1 SB_37102| Best HMM Match : zf-C2H2 (HMM E-Value=0) 26 6.7 SB_39407| Best HMM Match : TIG (HMM E-Value=0) 26 6.7 SB_23062| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 8.9 SB_20715| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 8.9 >SB_23131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 31.9 bits (69), Expect = 0.10 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = -2 Query: 277 LSTFVSERFTKMAKR---TKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTC 128 +ST S + K+ R T+ GIT T Y +S +K+V + T+ A TC Sbjct: 1 MSTHYSSPYKKLVPRQLTTRWSGITCMMSTHYSSSYKKLVPRQLTTRWASITC 53 Score = 28.3 bits (60), Expect = 1.3 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = -2 Query: 277 LSTFVSERFTKMAKR---TKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTC 128 +ST S + K+ R T+ IT T Y +S +K+V + T+ + TC Sbjct: 28 MSTHYSSSYKKLVPRQLTTRWASITCMMSTHYSSSYKKLVPRSLTTRWSGITC 80 >SB_59058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 377 Score = 28.7 bits (61), Expect = 0.95 Identities = 12/54 (22%), Positives = 24/54 (44%) Frame = +3 Query: 24 VVENPQAPPATVLLHRLQXQMPTQERFIASLPQNEQVYFACWVTSIFLTILRRE 185 V P + +L+ +++ AS + E ++ CWV S F+T + + Sbjct: 144 VTNKPSSASRGLLVLLFSQAAALRKKIAASCWEKESEFYECWVASFFITTAKTQ 197 >SB_51975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 809 Score = 28.7 bits (61), Expect = 0.95 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -1 Query: 257 EVYQNGQTYQKGWNYWQIWHTLRCL 183 + YQ + GW WQIW LR + Sbjct: 644 DTYQGRPLMKYGWLKWQIWRALRLI 668 >SB_12488| Best HMM Match : PAN (HMM E-Value=0.0087) Length = 124 Score = 28.3 bits (60), Expect = 1.3 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -1 Query: 299 MNSAGRCSVNFCIGEVYQNGQ-TYQKGWNY 213 M+S G C +N C VYQ Q Q+GW Y Sbjct: 83 MDSGGTCELNHC-EAVYQKAQGIEQRGWLY 111 >SB_7587| Best HMM Match : zf-C2H2 (HMM E-Value=3.5e-13) Length = 351 Score = 28.3 bits (60), Expect = 1.3 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -2 Query: 190 GASLRKMVKKMEVTQHAKYTCSFCGK 113 G +K ++ E++ H KY CS CGK Sbjct: 210 GGVTKKQIQSNEIS-HKKYVCSTCGK 234 >SB_57006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 604 Score = 27.5 bits (58), Expect = 2.2 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 111 SLPQNEQVYFACWVTSIFLTIL 176 S P + V FA W SIFLTI+ Sbjct: 133 SAPTSLSVIFAAWFLSIFLTII 154 >SB_56509| Best HMM Match : Ebp2 (HMM E-Value=2.1) Length = 298 Score = 27.5 bits (58), Expect = 2.2 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 133 TCSFCGKDAMKRS 95 TC+FCGKDA K S Sbjct: 243 TCNFCGKDARKTS 255 >SB_35194| Best HMM Match : EGF_2 (HMM E-Value=0) Length = 960 Score = 27.1 bits (57), Expect = 2.9 Identities = 11/38 (28%), Positives = 16/38 (42%) Frame = -2 Query: 124 FCGKDAMKRSCVGIWXCKRCKRTVAGGAWGFSTTAAAA 11 +C C+ W KRC + G +GF+ T A Sbjct: 594 YCDHVTGSCECLPGWTGKRCDQACPSGTYGFNCTLPCA 631 >SB_50779| Best HMM Match : DUF885 (HMM E-Value=1.4e-17) Length = 815 Score = 26.2 bits (55), Expect = 5.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 257 EVYQNGQTYQKGWNYWQIWHTLRCL 183 +VY+N + G WQIW LR + Sbjct: 643 DVYRNEPLQRYGMLKWQIWRALRLI 667 >SB_148| Best HMM Match : PRKCSH (HMM E-Value=2.4) Length = 438 Score = 26.2 bits (55), Expect = 5.1 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +1 Query: 40 KLLLLQSSCIAYKXRCRHKNVS*HPYHKMSKYTLRVGL 153 +++ LQS YK C KNV HP Y LR+GL Sbjct: 110 RVVTLQSDSYPYK--CYIKNVLSHPQESQESY-LRLGL 144 >SB_37102| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 618 Score = 25.8 bits (54), Expect = 6.7 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -2 Query: 178 RKMVKKMEVTQHAKYTCSFCGKDAMKRS 95 R+ VK + + + KY C C KD + S Sbjct: 410 REQVKDLFIKEGEKYRCRLCSKDFTRLS 437 >SB_39407| Best HMM Match : TIG (HMM E-Value=0) Length = 1710 Score = 25.8 bits (54), Expect = 6.7 Identities = 15/51 (29%), Positives = 22/51 (43%) Frame = -2 Query: 265 VSERFTKMAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGK 113 +S +TK+ RT+K I GKY +++ V YT S K Sbjct: 1245 MSSSYTKIICRTQKSHIPGKYNVSVSVGVQQCACTSHVGCSFAYTTSLTPK 1295 >SB_23062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 25.4 bits (53), Expect = 8.9 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 257 EVYQNGQTYQKGWNYWQIWHTLRCL 183 +VYQ + + G WQIW LR + Sbjct: 558 DVYQVNKLQKFGMLKWQIWRALRLI 582 >SB_20715| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 575 Score = 25.4 bits (53), Expect = 8.9 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 106 MKRSCVGIWXCKRCKRTVA 50 +KR+ G W CK CK+T + Sbjct: 552 LKRAPKGGWYCKFCKKTTS 570 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,518,581 Number of Sequences: 59808 Number of extensions: 218106 Number of successful extensions: 568 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 568 length of database: 16,821,457 effective HSP length: 71 effective length of database: 12,575,089 effective search space used: 364677581 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -