BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_D11 (828 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF047657-2|AAK18950.2| 358|Caenorhabditis elegans Serpentine re... 30 2.3 U22831-4|AAK20066.1| 633|Caenorhabditis elegans Hypothetical pr... 28 9.4 >AF047657-2|AAK18950.2| 358|Caenorhabditis elegans Serpentine receptor, class h protein270 protein. Length = 358 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = -3 Query: 781 KRVLNVPSFVLFNGHKIMLIRVRCIPIFAYSEGSYLVKILILS 653 K + N P FVL ++++I V + + E + VK+L + Sbjct: 177 KEIRNAPIFVLATDFRLLVITVSLVAVLLVGESLFFVKLLFFN 219 >U22831-4|AAK20066.1| 633|Caenorhabditis elegans Hypothetical protein F47D12.5 protein. Length = 633 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 509 VPVPRGPVVCGLH*QHALFDQMCPSL 586 +PV R ++CG H Q F Q+C S+ Sbjct: 73 LPVLRSLIICGRHLQSDDFQQLCESI 98 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,200,593 Number of Sequences: 27780 Number of extensions: 384314 Number of successful extensions: 784 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 766 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 784 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2050970610 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -