BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_D07 (409 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0490 + 22672241-22674679 27 5.7 02_03_0074 + 14781763-14784191,14784888-14784978,14785180-147852... 23 6.3 >01_05_0490 + 22672241-22674679 Length = 812 Score = 27.1 bits (57), Expect = 5.7 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = +3 Query: 96 PSLSSSFPRQYCSKTCQSSKKHKHI*NFDSSFTLRSFNNFS*YKWR 233 PS+++S YC+ ++K K I F + TL N++ KW+ Sbjct: 716 PSVTASPAPAYCASPDVNAKADKFIERFRAGLTLEKINSYR-EKWQ 760 >02_03_0074 + 14781763-14784191,14784888-14784978,14785180-14785230, 14785882-14785947,14786509-14786610 Length = 912 Score = 23.0 bits (47), Expect(2) = 6.3 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = -1 Query: 361 HLHRQDPVQQVHHHH 317 H H Q Q HHHH Sbjct: 158 HHHSQPQQPQSHHHH 172 Score = 22.2 bits (45), Expect(2) = 6.3 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = -1 Query: 328 HHHHLCLID 302 HHHHL ++D Sbjct: 196 HHHHLVVVD 204 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,889,554 Number of Sequences: 37544 Number of extensions: 149827 Number of successful extensions: 433 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 420 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 433 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 718652880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -