BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_D05 (793 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochr... 26 0.30 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 25 0.92 DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory pro... 23 3.7 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 22 4.9 >AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q3 protein. Length = 143 Score = 26.2 bits (55), Expect = 0.30 Identities = 27/115 (23%), Positives = 46/115 (40%), Gaps = 9/115 (7%) Frame = -3 Query: 458 LLLAENVDEKIYKSAQDICLEIGTMFQIQ--DDFIDCFGDEIKTGKVGTDIQERKCTWLA 285 +LLA + + ++ Q I ++ +FQ Q D+ + GD + ++QE K A Sbjct: 10 MLLANHKNVQVGDLVQKIAQKLQVLFQDQIVDEMVTVLGD-LHRKPTYNNLQEMKYLERA 68 Query: 284 VQALQRCTEAQRTV-------FKACYGSSEPAHVERIKRLYEDLHLPQIYKHQEK 141 ++ R + + F C G P +Y+ H P IY EK Sbjct: 69 IKESLRLYPSVHFISRKLGEDFVTCNGLKLPKSTITHLHIYDLHHNPDIYPDPEK 123 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 24.6 bits (51), Expect = 0.92 Identities = 14/70 (20%), Positives = 28/70 (40%) Frame = +3 Query: 132 VHRFFLMLVYLREVKVFVKSFYAFHMCWFTATITGFEYCTLCFSTALQRLNCQPSTFALL 311 V F + ++L ++V S + W+ T E CT ST + + P+ Sbjct: 3 VGSFTFLAIWLYLTAIYVSSRKSDSGIWYWQCNTDEETCTRISSTVSRNTDTYPTLETCR 62 Query: 312 YICTNFTSFY 341 +C + + + Sbjct: 63 LVCGKYGALW 72 >DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory protein 20 protein. Length = 124 Score = 22.6 bits (46), Expect = 3.7 Identities = 9/38 (23%), Positives = 20/38 (52%) Frame = -3 Query: 449 AENVDEKIYKSAQDICLEIGTMFQIQDDFIDCFGDEIK 336 A+ V + +YK+ QD ++ + + ++ DE+K Sbjct: 85 AKTVIQHLYKNKQDWWKQLEAKYDPEHTYVKAHEDELK 122 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 22.2 bits (45), Expect = 4.9 Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = +3 Query: 3 TGIVSHLLXYC-LMLPIVRNIQQLFKENAGGLYCYIFNLSYNIVVHRFFLMLVYL 164 T ++ H+ L L R+I + K + I+ +YNIV +VY+ Sbjct: 7 TDVLKHVWFLSKLFLLCPRSIDEKIKRQERHSFYKIYKYTYNIVAVSLTAYMVYI 61 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,796 Number of Sequences: 336 Number of extensions: 4082 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21480183 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -