BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_D05 (793 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-15|CAJ14166.1| 271|Anopheles gambiae predicted protein... 24 6.2 AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. 24 6.2 >CR954257-15|CAJ14166.1| 271|Anopheles gambiae predicted protein protein. Length = 271 Score = 23.8 bits (49), Expect = 6.2 Identities = 12/49 (24%), Positives = 24/49 (48%) Frame = -2 Query: 204 GTHKTTLRRPSPPADIQASRKSDVRQYYKTN*KYNNRGRPRSL*KVVGY 58 G + LRR S P+ ++AS + ++ + +GR + ++ GY Sbjct: 56 GWYTPRLRRSSRPSSMRASTMKKLNEWLDAYQQERGKGRSMTDLRLAGY 104 >AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. Length = 115 Score = 23.8 bits (49), Expect = 6.2 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +3 Query: 159 YLREVKVFVK--SFYAFHM-CWFTATITGFEYCTLC 257 Y KV+V Y H+ C AT G +CTLC Sbjct: 25 YAAAEKVWVDRDKVYCGHLDCTRVATFKGERFCTLC 60 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 826,077 Number of Sequences: 2352 Number of extensions: 15619 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83160600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -