BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_D05 (793 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 22 7.5 AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding pr... 22 7.5 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 9.9 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 21.8 bits (44), Expect = 7.5 Identities = 11/43 (25%), Positives = 18/43 (41%) Frame = -3 Query: 224 SSEPAHVERIKRLYEDLHLPQIYKHQEKAMYDNIIRQIENITI 96 S EP + + Y+ + + +K Y N I IE I + Sbjct: 76 SKEPKIISSLSNNYKYSNYNNYNNYNKKLYYKNYIINIEQIPV 118 >AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding protein protein. Length = 132 Score = 21.8 bits (44), Expect = 7.5 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 371 DDFIDCFGDEIKTGKVGTDI 312 DDF+ G I T KVG+ + Sbjct: 18 DDFMKALGVGIMTRKVGSSV 37 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.4 bits (43), Expect = 9.9 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +1 Query: 493 CGLVFYNSVVTIQSK*RIVCFSI 561 CGL F + +++ Q I+C +I Sbjct: 655 CGLRFEDPMISFQPGDTIICINI 677 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 220,484 Number of Sequences: 438 Number of extensions: 4748 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25003662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -