BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_D01 (662 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF022980-1|AAG24194.1| 346|Caenorhabditis elegans Serpentine re... 28 5.1 Z72508-1|CAA96641.1| 342|Caenorhabditis elegans Hypothetical pr... 27 9.0 >AF022980-1|AAG24194.1| 346|Caenorhabditis elegans Serpentine receptor, class h protein36 protein. Length = 346 Score = 28.3 bits (60), Expect = 5.1 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 398 FVLIKISILFSPFAHYCVIK 339 F+ I LF PFAH+CV++ Sbjct: 20 FIYSSIITLFYPFAHFCVLR 39 >Z72508-1|CAA96641.1| 342|Caenorhabditis elegans Hypothetical protein F28H7.1 protein. Length = 342 Score = 27.5 bits (58), Expect = 9.0 Identities = 17/45 (37%), Positives = 21/45 (46%) Frame = -2 Query: 622 FLLLVFGIXINERLXXRFIPVPLRCRIFFFNFKCIFLYIFCNVYI 488 FL F + N+ L F+P L IF+ F IF I C YI Sbjct: 110 FLYRFFVLFNNQFLTRWFMPYGLLTSIFYLIFHVIFWTICCWKYI 154 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,730,229 Number of Sequences: 27780 Number of extensions: 236770 Number of successful extensions: 450 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 450 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1486926498 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -