BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_C22 (598 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 26 0.21 AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 22 3.4 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 21 6.0 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 26.2 bits (55), Expect = 0.21 Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 4/48 (8%) Frame = -1 Query: 208 DVQANQMRWQQ----QLHSLPATWQVISLVPVCQSTVDVMLCVRAKFE 77 ++QA+Q++W + L S+P + I L VC ST+ + F+ Sbjct: 287 ELQASQIKWTRIAYMALASVPFIFDSIHLCDVCYSTIGTVSWCELNFD 334 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 22.2 bits (45), Expect = 3.4 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +1 Query: 526 RRSYWAKEVFSMVPVSII 579 +RS+WA +F ++ S+I Sbjct: 135 KRSFWAVTIFLVLAASVI 152 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 21.4 bits (43), Expect = 6.0 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 555 EHLLGPV*SSYEHQCAFNLLSDD 487 EHLLG + + Q FN+ S D Sbjct: 133 EHLLGHLQTDLMGQSIFNITSPD 155 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,004 Number of Sequences: 336 Number of extensions: 2729 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -