BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_C14 (755 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 24 1.5 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 24 1.5 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 24 1.5 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 24 1.5 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +1 Query: 583 IALYLNKNNSQAVNVKRIKVTKNLIVGLNH 672 +++ L+KNN Q +++ + K T LNH Sbjct: 298 LSMKLSKNNDQCLDLSKTKETNLEKSNLNH 327 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +1 Query: 583 IALYLNKNNSQAVNVKRIKVTKNLIVGLNH 672 +++ L+KNN Q +++ + K T LNH Sbjct: 190 LSMKLSKNNDQCLDLSKTKETNLEKSNLNH 219 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +1 Query: 649 NLIVGLNHFTLISLNSTGIDIQTYHTSIYKDG 744 +++V + FTL+S+ T + I+ + KDG Sbjct: 167 DVVVPITQFTLLSIGETAMGIKLNASDNDKDG 198 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +1 Query: 649 NLIVGLNHFTLISLNSTGIDIQTYHTSIYKDG 744 +++V + FTL+S+ T + I+ + KDG Sbjct: 167 DVVVPITQFTLLSIGETAMGIKLNASDNDKDG 198 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,980 Number of Sequences: 336 Number of extensions: 2940 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -