BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_C12 (474 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0632 - 4647271-4648704 33 0.089 10_08_1003 - 22162526-22163155,22163305-22163448,22163565-221636... 29 1.4 09_04_0501 + 18153252-18153453,18153973-18154224,18154809-181550... 28 4.4 03_03_0274 - 16089322-16089365,16089604-16089616,16090367-160907... 28 4.4 05_06_0277 + 26885621-26886064,26886148-26886317,26887038-268879... 27 5.8 01_06_0847 + 32411521-32411619,32411737-32411851,32412292-324123... 27 5.8 06_03_0924 - 25976629-25976979,25977471-25978424,25978512-259785... 27 7.7 04_01_0618 - 8094991-8097288 27 7.7 >03_01_0632 - 4647271-4648704 Length = 477 Score = 33.5 bits (73), Expect = 0.089 Identities = 23/69 (33%), Positives = 35/69 (50%) Frame = -3 Query: 208 REALETECAKCTEAQKKGTRRVIGHLINNESKSWNELTAKYDPEXKFTAKDEKELRESKA 29 +EA T C K TE++ TRR L+ ++ +E+ AK + KD K ++E+ Sbjct: 251 KEAGFTSCMKSTESELAETRRENARLLESQRSGRDEI-AKLRDILRQAVKDTKVVKEA-L 308 Query: 28 EEHXGETTA 2 EE GE A Sbjct: 309 EEARGENAA 317 >10_08_1003 - 22162526-22163155,22163305-22163448,22163565-22163692, 22163794-22164066,22164416-22164689 Length = 482 Score = 29.5 bits (63), Expect = 1.4 Identities = 25/94 (26%), Positives = 42/94 (44%), Gaps = 5/94 (5%) Frame = -3 Query: 289 RLLQPYIKCILDKDRCAPDAKELKEHIREALETECAKCTEAQKK---GTRRVI--GHLIN 125 ++LQ I D RCAPD L +H+ EAL+ + +Q + G++ H++ Sbjct: 295 KVLQELAVSIRDHHRCAPDV--LSDHLHEALQ-DLNSAIRSQPRLFLGSKHACANSHVLM 351 Query: 124 NESKSWNELTAKYDPEXKFTAKDEKELRESKAEE 23 + S + T P K E R +KA++ Sbjct: 352 ELNSSKHTATRTTLPSFKTDGTSLLERRNTKADQ 385 >09_04_0501 + 18153252-18153453,18153973-18154224,18154809-18155015, 18155198-18157046,18157334-18157381,18158222-18158291, 18158380-18158475,18158583-18158621,18158714-18158924, 18159037-18159178,18159275-18159407,18159762-18159878 Length = 1121 Score = 27.9 bits (59), Expect = 4.4 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = -2 Query: 254 QGQVCP*R*GVEGTHQGGTRDRMREMYRSPEEGYSTCYRPSN 129 +G VC EG + G R R RE+ E YS C RPS+ Sbjct: 220 KGSVCVAERRREGRGEEGRR-RSRELMEMEMEMYSRCARPSH 260 >03_03_0274 - 16089322-16089365,16089604-16089616,16090367-16090714, 16090771-16090974,16091403-16091504,16091710-16091741, 16092668-16093655,16094461-16094711,16095786-16097795, 16097903-16097954 Length = 1347 Score = 27.9 bits (59), Expect = 4.4 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 192 PNARNVPKPRRRVL 151 P A NVP+PRRRVL Sbjct: 1013 PGAANVPRPRRRVL 1026 >05_06_0277 + 26885621-26886064,26886148-26886317,26887038-26887941, 26888544-26888575,26888862-26888928,26889116-26889173, 26889329-26889421,26890366-26890480,26890847-26890894, 26891012-26891057,26891161-26891231,26891865-26891870, 26891991-26892038,26892439-26892488,26892892-26893154 Length = 804 Score = 27.5 bits (58), Expect = 5.8 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = -2 Query: 287 TSSALHQMYPRQGQVCP*R*GVEGTHQGGTRDRMREMYRSPEEGYSTCYRPS 132 T+S+ + P + P R V + RDR++E RSP++ S PS Sbjct: 265 TTSSHRERSPVRRNGSPRRSPVRSIGRSPQRDRVKEQVRSPKQAQSRSRSPS 316 >01_06_0847 + 32411521-32411619,32411737-32411851,32412292-32412375, 32412430-32413478,32414690-32416371,32416477-32416586, 32417634-32418430,32418839-32418951,32419147-32419194, 32419425-32419652,32419732-32419829,32419967-32420019 Length = 1491 Score = 27.5 bits (58), Expect = 5.8 Identities = 23/83 (27%), Positives = 37/83 (44%) Frame = -3 Query: 298 SNSRLLQPYIKCILDKDRCAPDAKELKEHIREALETECAKCTEAQKKGTRRVIGHLINNE 119 +N R + K +K +CA K L E + +ETE K TE +K + + + Sbjct: 249 ANKRAEEEKQKAAREK-KCANSEKSLAEKNKNLIETERKKLTE--EKSRAECLFAKLEEQ 305 Query: 118 SKSWNELTAKYDPEXKFTAKDEK 50 K +L + + E K A D+K Sbjct: 306 KKLNEDLRVRIEVERK-NAVDQK 327 >06_03_0924 - 25976629-25976979,25977471-25978424,25978512-25978565, 25979135-25979254,25979357-25979532,25979624-25980107, 25980541-25980744,25981671-25981877,25982179-25982271, 25982433-25982621,25983364-25983423,25983591-25983927, 25984195-25984432,25984614-25984816,25985549-25986554, 25987125-25987290,25987715-25987824,25987944-25988195, 25988360-25988402,25988488-25988550,25989512-25989624, 25990787-25990838 Length = 1824 Score = 27.1 bits (57), Expect = 7.7 Identities = 29/110 (26%), Positives = 43/110 (39%), Gaps = 7/110 (6%) Frame = -3 Query: 346 DKYTDRYDNVNLDEVLSNS--RLLQPYIKCILDKDRCAPDAKELKEHIREALETECAKCT 173 D Y ++N D V NS +QP C+ CA + L +H + E + C Sbjct: 346 DFYPLEHENWENDIVWGNSPTTAIQP---CLTS---CAISKESLDDHNEDQAEGYVSGCW 399 Query: 172 EAQKKGTRRVI-----GHLINNESKSWNELTAKYDPEXKFTAKDEKELRE 38 + Q K + GH +S S+ Y P K TA++ L E Sbjct: 400 DVQNKFHSSSVMADPFGHTEIPDSTSYRSPENSYSPLRKETAQENNSLDE 449 >04_01_0618 - 8094991-8097288 Length = 765 Score = 27.1 bits (57), Expect = 7.7 Identities = 18/55 (32%), Positives = 26/55 (47%) Frame = -3 Query: 175 TEAQKKGTRRVIGHLINNESKSWNELTAKYDPEXKFTAKDEKELRESKAEEHXGE 11 TEA K+G RR G N +S + +P + K+E+E E + EE E Sbjct: 222 TEAVKQGERREGGQFHENLERS--TVKTAIEPVVEQQKKEEEEEEEEEEEEEEEE 274 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,276,057 Number of Sequences: 37544 Number of extensions: 215671 Number of successful extensions: 571 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 571 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 967140324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -