BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_C09 (580 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g52720.1 68416.m05808 carbonic anhydrase family protein low s... 54 5e-08 At5g04180.1 68418.m00406 carbonic anhydrase family protein simil... 50 1e-06 At1g08065.1 68414.m00882 carbonic anhydrase family protein simil... 47 1e-05 At4g20990.1 68417.m03038 carbonic anhydrase family protein simil... 42 2e-04 At3g52720.2 68416.m05809 carbonic anhydrase family protein low s... 41 7e-04 At2g28210.1 68415.m03425 carbonic anhydrase family protein simil... 39 0.002 At1g08080.1 68414.m00884 carbonic anhydrase family protein simil... 39 0.002 At4g21000.1 68417.m03039 carbonic anhydrase family protein simil... 39 0.003 At5g57390.1 68418.m07170 ovule development protein, putative sim... 31 0.56 At4g04970.1 68417.m00722 callose synthase, putative / 1,3-beta-g... 31 0.56 At2g30020.1 68415.m03652 protein phosphatase 2C, putative / PP2C... 29 3.0 At3g56980.1 68416.m06342 basic helix-loop-helix (bHLH) family pr... 28 3.9 At2g28450.1 68415.m03456 zinc finger (CCCH-type) family protein ... 28 5.2 At2g03140.1 68415.m00267 CAAX amino terminal protease family pro... 27 6.8 At1g16510.1 68414.m01974 auxin-responsive family protein similar... 27 9.0 >At3g52720.1 68416.m05808 carbonic anhydrase family protein low similarity to storage protein (dioscorin) [Dioscorea cayenensis] GI:433463; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 284 Score = 54.4 bits (125), Expect = 5e-08 Identities = 29/65 (44%), Positives = 38/65 (58%) Frame = -1 Query: 412 TERFYTYKGSLTTPPCAEAVTWVIFSDYLPISVFQMDNFRGLLSNLNLPLVDNFRQLQPL 233 T ++Y Y GSLTTPPC+E V+W I +S Q++ R S L+ +N R QPL Sbjct: 201 TRKYYRYIGSLTTPPCSENVSWTILGKVRSMSKEQVELLR---SPLDTSFKNNSRPCQPL 257 Query: 232 FGRRV 218 GRRV Sbjct: 258 NGRRV 262 >At5g04180.1 68418.m00406 carbonic anhydrase family protein similar to storage protein (dioscorin) [Dioscorea cayenensis] GI:433463; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 277 Score = 50.0 bits (114), Expect = 1e-06 Identities = 29/70 (41%), Positives = 36/70 (51%) Frame = -1 Query: 421 GLDTERFYTYKGSLTTPPCAEAVTWVIFSDYLPISVFQMDNFRGLLSNLNLPLVDNFRQL 242 G D +FY Y+GSLTTPPC E V W I + +S Q+D L N R Sbjct: 191 GWDLTKFYEYRGSLTTPPCTEDVMWTIINKVGTVSREQID---VLTDARRGGYEKNARPA 247 Query: 241 QPLFGRRVFV 212 QPL GR V++ Sbjct: 248 QPLNGRLVYL 257 >At1g08065.1 68414.m00882 carbonic anhydrase family protein similar to storage protein (dioscorin) [Dioscorea cayenensis] GI:433463; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 263 Score = 46.8 bits (106), Expect = 1e-05 Identities = 29/95 (30%), Positives = 50/95 (52%), Gaps = 3/95 (3%) Frame = -1 Query: 580 QHPDGL-CVLAFFYQXVEFDAKLLS--PIVKNLTAIENFNSTLQLPHTFSLSSILSGLDT 410 Q DG V+AFFY+ + D LL+ +K +T +++ H + G ++ Sbjct: 136 QSKDGRNAVVAFFYKLGKPDYFLLTLERYLKRITDTHESQEFVEMVHPRTF-----GFES 190 Query: 409 ERFYTYKGSLTTPPCAEAVTWVIFSDYLPISVFQM 305 + +Y + GSLTTPPC+E V W I + +++ Q+ Sbjct: 191 KHYYRFIGSLTTPPCSENVIWTISKEMRTVTLKQL 225 >At4g20990.1 68417.m03038 carbonic anhydrase family protein similar to storage protein (dioscorin) [Dioscorea cayenensis] GI:433463; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 267 Score = 42.3 bits (95), Expect = 2e-04 Identities = 22/66 (33%), Positives = 31/66 (46%) Frame = -1 Query: 412 TERFYTYKGSLTTPPCAEAVTWVIFSDYLPISVFQMDNFRGLLSNLNLPLVDNFRQLQPL 233 T +FY Y GSLT PPC E V W + ++ M+ L ++ N R +Q Sbjct: 199 TRKFYRYIGSLTVPPCTEGVIWTVVK---RVNTISMEQITALRQAVDDGFETNSRPVQDS 255 Query: 232 FGRRVF 215 GR V+ Sbjct: 256 KGRSVW 261 >At3g52720.2 68416.m05809 carbonic anhydrase family protein low similarity to storage protein (dioscorin) [Dioscorea cayenensis] GI:433463; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 230 Score = 40.7 bits (91), Expect = 7e-04 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = -1 Query: 412 TERFYTYKGSLTTPPCAEAVTWVI 341 T ++Y Y GSLTTPPC+E V+W I Sbjct: 201 TRKYYRYIGSLTTPPCSENVSWTI 224 >At2g28210.1 68415.m03425 carbonic anhydrase family protein similar to storage protein (dioscorin) [Dioscorea cayenensis] GI:433463; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 217 Score = 39.1 bits (87), Expect = 0.002 Identities = 24/75 (32%), Positives = 35/75 (46%) Frame = -1 Query: 565 LCVLAFFYQXVEFDAKLLSPIVKNLTAIENFNSTLQLPHTFSLSSILSGLDTERFYTYKG 386 L V+ Y+ D+ L + L+AI + N + I G + +FY Y G Sbjct: 131 LAVVTVLYKIGRPDS-FLGLLENKLSAITDQNEAEKYVDVIDPRDIKIG--SRKFYRYIG 187 Query: 385 SLTTPPCAEAVTWVI 341 SLTTPPC + V W + Sbjct: 188 SLTTPPCTQNVIWTV 202 >At1g08080.1 68414.m00884 carbonic anhydrase family protein similar to storage protein (dioscorin) [Dioscorea cayenensis] GI:433463; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 275 Score = 39.1 bits (87), Expect = 0.002 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -1 Query: 418 LDTERFYTYKGSLTTPPCAEAVTWVI 341 + + ++Y Y GSLTTPPC + VTW + Sbjct: 205 IGSRKYYRYTGSLTTPPCTQNVTWSV 230 >At4g21000.1 68417.m03039 carbonic anhydrase family protein similar to storage protein (dioscorin) [Dioscorea cayenensis] GI:433463; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 260 Score = 38.7 bits (86), Expect = 0.003 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = -1 Query: 415 DTERFYTYKGSLTTPPCAEAVTWVI 341 +T FY Y GSLT PPC E V W + Sbjct: 199 ETNNFYRYIGSLTIPPCTEGVIWTV 223 >At5g57390.1 68418.m07170 ovule development protein, putative similar to ovule development protein AINTEGUMENTA (GI:1209099)[Arabidopsis thaliana] Length = 555 Score = 31.1 bits (67), Expect = 0.56 Identities = 20/49 (40%), Positives = 26/49 (53%) Frame = -2 Query: 255 TSGSYNRCLVAVSSSESHQRTLSSRRPNSTTPNGTGLDTRSPKMTSSTS 109 +S SY+ L SSS SHQ LS N+ N + +P +TSSTS Sbjct: 10 SSSSYDSSLSPSSSSSSHQNWLSFSLSNN---NNNFNSSSNPNLTSSTS 55 >At4g04970.1 68417.m00722 callose synthase, putative / 1,3-beta-glucan synthase, putative similar to callose synthase 1 catalytic subunit GI:13649388 from [Arabidopsis thaliana] Length = 1768 Score = 31.1 bits (67), Expect = 0.56 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = -1 Query: 388 GSLTTPPCAEAVTWVIFSDYLPISV-FQMDNFRGLLSNLNLPLVDNFRQLQP 236 G L PP A+ + D+L + FQ+DN R NL L L ++ +LQP Sbjct: 51 GDLPKPPFADFTPRMDLMDWLGLLFGFQIDNVRNQRENLVLHLANSQMRLQP 102 >At2g30020.1 68415.m03652 protein phosphatase 2C, putative / PP2C, putative similar to protein phosphatase 2C (GI:4587992){Arabidopsis thaliana} Length = 396 Score = 28.7 bits (61), Expect = 3.0 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -2 Query: 240 NRCLVAVSSSESHQRTLSSRRPNSTTPNGTGLDTRSPK 127 N+ + S ES TLS R+P +++P+ SPK Sbjct: 22 NKSSILSSPQESLSLTLSHRKPQTSSPSSPSTTVSSPK 59 >At3g56980.1 68416.m06342 basic helix-loop-helix (bHLH) family protein Length = 258 Score = 28.3 bits (60), Expect = 3.9 Identities = 10/17 (58%), Positives = 15/17 (88%) Frame = -1 Query: 451 HTFSLSSILSGLDTERF 401 H FS+S++LSGL+ +RF Sbjct: 190 HNFSISNVLSGLEEDRF 206 >At2g28450.1 68415.m03456 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 809 Score = 27.9 bits (59), Expect = 5.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 443 ESMRQLQSGVEVLDGR 490 E+ QLQSGVE+LDG+ Sbjct: 214 ENAEQLQSGVEILDGK 229 >At2g03140.1 68415.m00267 CAAX amino terminal protease family protein very low similarity to SP|Q40863 Late embryogenesis abundant protein EMB8 from Picea glauca; contains Pfam profile PF02517 CAAX amino terminal protease family protein Length = 1805 Score = 27.5 bits (58), Expect = 6.8 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +2 Query: 113 VDDVIFG--LLVSNPVPFGVVEFGLLELRVL*CDSDEDTATKQRL 241 VDDV+ G +L + P PF F LL +L D D + + RL Sbjct: 98 VDDVVVGEWILFTTPTPFN--RFVLLRCSLLSFDDDSEKSLSDRL 140 >At1g16510.1 68414.m01974 auxin-responsive family protein similar to indole-3-acetic acid induced protein (SP:D14414) [Vigna radiata.]; ESTs gb|AA712892 and gb|Z17613 come from this gene Length = 147 Score = 27.1 bits (57), Expect = 9.0 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +2 Query: 11 PPPLWSXWSVQRVTPVPYYLSVVIGYIYIYLFIEVDD-VIFGLLVSNPVPFGVV 169 PPP WS +RV VP G++ +Y+ E++ V+ L+++P+ G++ Sbjct: 39 PPPPWSICPARRVNTVP------AGHVPVYVGEEMERFVVSAELMNHPIFVGLL 86 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,763,067 Number of Sequences: 28952 Number of extensions: 276259 Number of successful extensions: 713 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 697 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 712 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1131744440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -