BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_C08 (706 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g14400.3 68417.m02222 ankyrin repeat family protein contains ... 29 2.3 At4g14400.2 68417.m02221 ankyrin repeat family protein contains ... 29 2.3 At4g14400.1 68417.m02220 ankyrin repeat family protein contains ... 29 2.3 At4g14390.1 68417.m02219 ankyrin repeat family protein contains ... 28 5.2 At1g51480.1 68414.m05794 disease resistance protein (CC-NBS-LRR ... 28 5.2 At5g07130.1 68418.m00813 laccase, putative / diphenol oxidase, p... 28 6.9 At1g44120.1 68414.m05096 C2 domain-containing protein / armadill... 27 9.2 >At4g14400.3 68417.m02222 ankyrin repeat family protein contains ankyrin repeats, Pfam domain PF00023 Length = 604 Score = 29.5 bits (63), Expect = 2.3 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +3 Query: 84 VCFQNGSFPLHSFSETQH 137 VC Q+GSFP+HS ++ +H Sbjct: 259 VCDQDGSFPIHSAAKNEH 276 >At4g14400.2 68417.m02221 ankyrin repeat family protein contains ankyrin repeats, Pfam domain PF00023 Length = 604 Score = 29.5 bits (63), Expect = 2.3 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +3 Query: 84 VCFQNGSFPLHSFSETQH 137 VC Q+GSFP+HS ++ +H Sbjct: 259 VCDQDGSFPIHSAAKNEH 276 >At4g14400.1 68417.m02220 ankyrin repeat family protein contains ankyrin repeats, Pfam domain PF00023 Length = 670 Score = 29.5 bits (63), Expect = 2.3 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +3 Query: 84 VCFQNGSFPLHSFSETQH 137 VC Q+GSFP+HS ++ +H Sbjct: 325 VCDQDGSFPIHSAAKNEH 342 >At4g14390.1 68417.m02219 ankyrin repeat family protein contains Pfam profile: PF00023 ankyrin repeat Length = 694 Score = 28.3 bits (60), Expect = 5.2 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +3 Query: 84 VCFQNGSFPLHSFSETQHK 140 VC Q+GSFP+H+ +E H+ Sbjct: 354 VCDQDGSFPIHTAAEKGHE 372 >At1g51480.1 68414.m05794 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 941 Score = 28.3 bits (60), Expect = 5.2 Identities = 23/62 (37%), Positives = 30/62 (48%), Gaps = 8/62 (12%) Frame = +1 Query: 37 KVVC--KCS---ALLLPWRSRCVFKMALFHFIP---FRKHNTNMPHNRLPVSINLLNSMQ 192 K+ C KCS LLLP+ + F F+P +TNM LP I+ L S+Q Sbjct: 614 KISCSSKCSNLSTLLLPYNKLVNISVGFFLFMPKLVVLDLSTNMSLIELPEEISNLCSLQ 673 Query: 193 YL 198 YL Sbjct: 674 YL 675 >At5g07130.1 68418.m00813 laccase, putative / diphenol oxidase, putative similar to laccase [Populus balsamifera subsp. trichocarpa][GI:3805960] Length = 484 Score = 27.9 bits (59), Expect = 6.9 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = -2 Query: 150 MRHICVVFPKRNEVEKSHFENTPT 79 + ++ VFPK+N + +++++ TPT Sbjct: 304 INNVSFVFPKQNSIMQAYYQGTPT 327 >At1g44120.1 68414.m05096 C2 domain-containing protein / armadillo/beta-catenin repeat family protein similar to CCLS 65 [Silene latifolia] GI:2570102; contains Pfam profiles PF00514: Armadillo/beta-catenin-like repeat, PF00168: C2 domain Length = 2114 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 47 VNAVHYYYPGGVGVFSKWLFSTS 115 +N HYY+ + V SK LFST+ Sbjct: 1649 INPEHYYFTVTIPVLSKMLFSTA 1671 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,351,850 Number of Sequences: 28952 Number of extensions: 247554 Number of successful extensions: 513 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 513 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1516419560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -