BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_C07 (433 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 23 4.6 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 23 6.1 AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR prot... 23 6.1 AJ439060-2|CAD27753.1| 135|Anopheles gambiae putative cytoskele... 23 6.1 AJ438610-10|CAD27482.1| 135|Anopheles gambiae putative cytoskel... 23 6.1 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 23 6.1 AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related ... 23 6.1 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 22 8.1 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 23.0 bits (47), Expect = 4.6 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = -1 Query: 91 RHQYCQSWILQVARQRQTPQTTCXSKS 11 RH ++W+ R + TPQ+ S++ Sbjct: 224 RHLERKAWVASFGRPKMTPQSLLASQT 250 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 22.6 bits (46), Expect = 6.1 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -2 Query: 285 AGGEHHHRINMDKYHPGYFG 226 A HHH + +HPG G Sbjct: 153 AAAMHHHHHHPHHHHPGLTG 172 >AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR protein. Length = 460 Score = 22.6 bits (46), Expect = 6.1 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = -2 Query: 243 HPGYFGKLGMRNFHFRKNKNFCPVLNLDKLWTLVSEQTRLKYASAPDGKV 94 HP + R+ K++NF + L L+TL RL Y +A + ++ Sbjct: 264 HPNGRNGILRRSSMSMKDRNFFINITLFALFTLSLRYDRLLYRTAGENRM 313 >AJ439060-2|CAD27753.1| 135|Anopheles gambiae putative cytoskeletal regulator protein. Length = 135 Score = 22.6 bits (46), Expect = 6.1 Identities = 8/25 (32%), Positives = 19/25 (76%) Frame = -3 Query: 104 MARSPSSILSKLDTTSC*AKANSPN 30 ++RS S++++ + T+C + A++PN Sbjct: 105 ISRSRSTVVNSYNLTTCPSWAHAPN 129 >AJ438610-10|CAD27482.1| 135|Anopheles gambiae putative cytoskeletal regulator protein. Length = 135 Score = 22.6 bits (46), Expect = 6.1 Identities = 8/25 (32%), Positives = 19/25 (76%) Frame = -3 Query: 104 MARSPSSILSKLDTTSC*AKANSPN 30 ++RS S++++ + T+C + A++PN Sbjct: 105 ISRSRSTVVNSYNLTTCPSWAHAPN 129 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 22.6 bits (46), Expect = 6.1 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = -3 Query: 401 RNIEPWPPQKRRLGS*EVMLVTDMVVSEST 312 R +EPW + +RLG+ +V+ T++ + + Sbjct: 337 RELEPWRAEVKRLGT-QVIGTTEVFLDRES 365 >AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related 2 protein protein. Length = 257 Score = 22.6 bits (46), Expect = 6.1 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +2 Query: 272 CSPPALPRPPGCLRCFPI 325 C+PP +P P C P+ Sbjct: 38 CNPPGIPGGPACAGLKPM 55 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 22.2 bits (45), Expect = 8.1 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = -2 Query: 270 HHRINMDKYHPGYFGK--LGMRNFHFR 196 +HRI +D+ H FG+ MR+ +R Sbjct: 111 NHRIQLDENHDPLFGRALFAMRDTRWR 137 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 451,811 Number of Sequences: 2352 Number of extensions: 8188 Number of successful extensions: 11 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 35717724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -