BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_C04 (740 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1442.12 |||CDP-diacylglycerol--serine O-phosphatidyltransfer... 26 6.5 SPAC26F1.05 |mug106||sequence orphan|Schizosaccharomyces pombe|c... 25 8.6 >SPCC1442.12 |||CDP-diacylglycerol--serine O-phosphatidyltransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 250 Score = 25.8 bits (54), Expect = 6.5 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = -2 Query: 604 CGALLFDAVFLYHSFVLVSETEMLWYNVKINVTLRNISGKCYF 476 CG F + FVL T + +NV +N ++ SGK F Sbjct: 132 CGFQTFLDTVILSLFVLCGLTRLARFNVSVNSIPKDGSGKSQF 174 >SPAC26F1.05 |mug106||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 115 Score = 25.4 bits (53), Expect = 8.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 402 FECYVTSMLCSCNFRFSPG 346 F+C V ++ C C F FS G Sbjct: 39 FDCIVVTIYCGCLFWFSNG 57 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,472,661 Number of Sequences: 5004 Number of extensions: 43574 Number of successful extensions: 96 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 94 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 96 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 351258950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -